Interferon alpha 2 (IFNA2) (NM_000605) Human Tagged ORF Clone
CAT#: RC221091
IFNA2 (Myc-DDK-tagged)-Human interferon, alpha 2 (IFNA2)
ORF Plasmid: tGFP
"NM_000605" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,990.00
Cited in 4 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | IFN-alpha-2; IFN-alphaA; IFNA; IFNA2B; leIF A |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC221091 representing NM_000605
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCTTGACCTTTGCTTTACTGGTGGCCCTCCTGGTGCTCAGCTGCAAGTCAAGCTGCTCTGTGGGCT GTGATCTGCCTCAAACCCACAGCCTGGGTAGCAGGAGGACCTTGATGCTCCTGGCACAGATGAGGAGAAT CTCTCTTTTCTCCTGCTTGAAGGACAGACATGACTTTGGATTTCCCCAGGAGGAGTTTGGCAACCAGTTC CAAAAGGCTGAAACCATCCCTGTCCTCCATGAGATGATCCAGCAGATCTTCAATCTCTTCAGCACAAAGG ACTCATCTGCTGCTTGGGATGAGACCCTCCTAGACAAATTCTACACTGAACTCTACCAGCAGCTGAATGA CCTGGAAGCCTGTGTGATACAGGGGGTGGGGGTGACAGAGACTCCCCTGATGAAGGAGGACTCCATTCTG GCTGTGAGGAAATACTTCCAAAGAATCACTCTCTATCTGAAAGAGAAGAAATACAGCCCTTGTGCCTGGG AGGTTGTCAGAGCAGAAATCATGAGATCTTTTTCTTTGTCAACAAACTTGCAAGAAAGTTTAAGAAGTAA GGAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC221091 representing NM_000605
Red=Cloning site Green=Tags(s) MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQF QKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSIL AVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_000605 |
ORF Size | 564 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_000605.4 |
RefSeq Size | 1142 bp |
RefSeq ORF | 567 bp |
Locus ID | 3440 |
UniProt ID | P01563 |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
MW | 21.4 kDa |
Gene Summary | This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded cytokine is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. The encoded protein is effective in reducing the symptoms and duration of the common cold and in treating many types of cancer, including some hematological malignancies and solid tumors. A deficiency of type I interferon in the blood is thought to be a hallmark of severe COVID-19 and may provide a rationale for a combined therapeutic approach. [provided by RefSeq, Aug 2020] |
Citations (4)
The use of this cDNA Clones has been cited in the following citations: |
---|
Low Prevalence of Interferon-α Autoantibodies in People Experiencing Long COVID Symptoms
,null,
The Journal of Infectious Diseases
,PubMed ID 36089700
[Interferon alpha 2]
|
Vaccine breakthrough hypoxemic COVID-19 pneumonia in patients with auto-Abs neutralizing type I IFNs
,null,
Science Immunology
,PubMed ID 35857576
[Interferon alpha 2]
|
Neutralizing Autoantibodies to Type I Interferons in COVID-19 Convalescent Donor Plasma
,Vazquez, SE;Bastard, P;Kelly, K;Gervais, A;Norris, PJ;Dumont, LJ;Casanova, JL;Anderson, MS;DeRisi, JL;,
Journal of clinical immunology
,PubMed ID 34009544
[Interferon alpha 2]
|
Longitudinal single-cell epitope and RNA-sequencing reveals the immunological impact of type 1 interferon autoantibodies in critical COVID-19
,van der Wijst, MGP;Vazquez, SE;Hartoularos, GC;Bastard, P;Grant, T;Bueno, R;Lee, DS;Greenland, JR;Sun, Y;Perez, R;Ogorodnikov, A;Ward, A;Mann, SA;Lynch, KL;Yun, C;Havlir, DV;Chamie, G;Marquez, C;Greenhouse, B;Lionakis, MS;Norris, PJ;Dumont, LJ;Kelly, K;Zhang, P;Zhang, Q;Gervais, A;Voyer, TL;Whatley, A;Si, Y;Byrne, A;Combes, AJ;Rao, AA;Song, YS;UCSF COMET consortium, ;Fragiadakis, GK;Kangelaris, K;Calfee, CS;Erle, DJ;Hendrickson, C;Krummel, MF;Woodruff, PG;Langelier, CR;Casanova, JL;Derisi, JL;Anderson, MS;Ye, CJ;,
bioRxiv : the preprint server for biology
,PubMed ID 33758859
[Interferon alpha 2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC221091L1 | Lenti ORF clone of Human interferon, alpha 2 (IFNA2), Myc-DDK-tagged |
CNY 4,800.00 |
|
RC221091L2 | Lenti ORF clone of Human interferon, alpha 2 (IFNA2), mGFP tagged |
CNY 4,800.00 |
|
RC221091L3 | Lenti ORF clone of Human interferon, alpha 2 (IFNA2), Myc-DDK-tagged |
CNY 4,800.00 |
|
RC221091L4 | Lenti ORF clone of Human interferon, alpha 2 (IFNA2), mGFP tagged |
CNY 4,800.00 |
|
RG221091 | IFNA2 (tGFP-tagged) - Human interferon, alpha 2 (IFNA2) |
CNY 4,000.00 |
|
SC300106 | IFNA2 (untagged)-Human interferon, alpha 2 (IFNA2) |
CNY 2,400.00 |
其它Interferon alpha 2产品