CD3D (NM_001040651) Human Tagged ORF Clone
CAT#: RC217875
- TrueORF®
CD3D (Myc-DDK-tagged)-Human CD3d molecule, delta (CD3-TCR complex) (CD3D), transcript variant 2
ORF Plasmid: tGFP
"NM_001040651" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CD3-DELTA; IMD19; T3D |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC217875 representing NM_001040651
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAACATAGCACGTTTCTCTCTGGCCTGGTACTGGCTACCCTTCTCTCGCAAGTGAGCCCCTTCAAGA TACCTATAGAGGAACTTGAGGACAGAGTGTTTGTGAATTGCAATACCAGCATCACATGGGTAGAGGGAAC GGTGGGAACACTGCTCTCAGACATTACAAGACTGGACCTGGGAAAACGCATCCTGGACCCACGAGGAATA TATAGGTGTAATGGGACAGATATATACAAGGACAAAGAATCTACCGTGCAAGTTCATTATCGAACTGCCG ACACACAAGCTCTGTTGAGGAATGACCAGGTCTATCAGCCCCTCCGAGATCGAGATGATGCTCAGTACAG CCACCTTGGAGGAAACTGGGCTCGGAACAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC217875 representing NM_001040651
Red=Cloning site Green=Tags(s) MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGI YRCNGTDIYKDKESTVQVHYRTADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001040651 |
ORF Size | 381 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001040651.2 |
RefSeq Size | 639 bp |
RefSeq ORF | 384 bp |
Locus ID | 915 |
UniProt ID | P04234 |
Protein Families | Druggable Genome |
Protein Pathways | Hematopoietic cell lineage, Primary immunodeficiency, T cell receptor signaling pathway |
MW | 14.48 kDa |
Gene Summary | The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene. Other variants may also exist, but the full-length natures of their transcripts has yet to be defined. [provided by RefSeq, Feb 2009] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
A novel method to generate T-cell receptor-deficient chimeric antigen receptor T cells
,Kamiya, T;Wong, D;Png, YT;Campana, D;,
Blood Adv
,PubMed ID 29507075
[CD3D]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC217875L3 | Lenti-ORF clone of CD3D (Myc-DDK-tagged)-Human CD3d molecule, delta (CD3-TCR complex) (CD3D), transcript variant 2 |
CNY 5,890.00 |
|
RC217875L4 | Lenti-ORF clone of CD3D (mGFP-tagged)-Human CD3d molecule, delta (CD3-TCR complex) (CD3D), transcript variant 2 |
CNY 5,890.00 |
|
RG217875 | CD3D (tGFP-tagged) - Human CD3d molecule, delta (CD3-TCR complex) (CD3D), transcript variant 2 |
CNY 4,370.00 |
|
SC311200 | CD3D (untagged)-Human CD3d molecule, delta (CD3-TCR complex) (CD3D), transcript variant 2 |
CNY 3,990.00 |