PRRX1 (NM_006902) Human Tagged ORF Clone
CAT#: RC213276
PRRX1 (Myc-DDK-tagged)-Human paired related homeobox 1 (PRRX1), transcript variant pmx-1a
ORF Plasmid: tGFP
"NM_006902" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
Cited in 4 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | AGOTC; PHOX1; PMX1; PRX-1; PRX1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC213276 representing NM_006902
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACCTCCAGCTACGGGCACGTTCTGGAGCGGCAACCGGCGCTGGGCGGCCGCTTGGACAGCCCGGGCA ACCTCGACACCCTGCAGGCGAAAAAGAACTTCTCCGTCAGTCACCTGCTAGACCTGGAGGAAGCCGGGGA CATGGTGGCGGCACAGGCGGATGAGAACGTGGGCGAGGCTGGCCGGAGCCTGCTGGAGTCGCCGGGACTC ACCAGCGGCAGCGACACCCCGCAGCAGGACAATGACCAGCTGAACTCAGAAGAAAAAAAGAAGAGAAAGC AGCGAAGGAATAGGACAACCTTCAATAGCAGCCAGCTGCAGGCTTTGGAGCGTGTCTTTGAGCGGACACA CTATCCTGATGCTTTTGTGCGAGAAGACCTTGCCCGCCGGGTGAACCTCACCGAGGCGAGAGTGCAGGTG TGGTTTCAGAACCGAAGAGCCAAGTTCCGCAGGAATGAGAGAGCCATGCTAGCCAATAAAAACGCTTCCC TCCTCAAATCCTACTCAGGAGACGTGACTGCTGTGGAGCAGCCCATCGTACCTCGTCCTGCTCCGAGACC CACCGATTATCTCTCCTGGGGGACAGCGTCTCCGTACAGATCCTCGTCCCTCCCAAGATGTTGTTTACAC GAGGGGCTTCATAACGGATTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC213276 representing NM_006902
Red=Cloning site Green=Tags(s) MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGL TSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVNLTEARVQV WFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYRSSSLPRCCLH EGLHNGF myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_006902 |
ORF Size | 651 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_006902.5 |
RefSeq Size | 4071 bp |
RefSeq ORF | 654 bp |
Locus ID | 5396 |
UniProt ID | P54821 |
Protein Families | Transcription Factors |
MW | 24.2 kDa |
Gene Summary | The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns. [provided by RefSeq, Jul 2008] |
Citations (4)
The use of this cDNA Clones has been cited in the following citations: |
---|
Cooperative interaction between ERα and the EMT-inducer ZEB1 reprograms breast cancer cells for bone metastasis
,null,
Nature Communications
,PubMed ID 35440541
[PRRX1]
|
Cooperative interaction between ERα and the EMT-inducer ZEB1 reprograms breast cancer cells for metastasis
,Ghahhari, N;Sznurkowska, M;Hulo, N;Bernasconi, L;Aceto, N;Picard, D;,
Research Square
[PRRX1]
|
Epigenetic state determines inflammatory sensing in neuroblastoma
,Wolpaw, A;Grossmann, L;Dong, M;Dessau, J;Brafford, P;Volgina, D;Rodriguez-Garcia, A;Uzun, Y;Powell, D;Tan, K;Hogarty, M;Maris, J;Dang, C;,
bioRxiv
[PRRX1]
|
Prediction and validation of protein-protein interactors from genome-wide DNA-binding data using a knowledge-based machine-learning approach
,Waardenberg, AJ;Homan, B;Mohamed, S;Harvey, RP;Bouveret, R;,
Open Biol
,PubMed ID 27683156
[PRRX1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC213276L1 | Lenti ORF clone of Human paired related homeobox 1 (PRRX1), transcript variant pmx-1a, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC213276L2 | Lenti ORF clone of Human paired related homeobox 1 (PRRX1), transcript variant pmx-1a, mGFP tagged |
CNY 5,890.00 |
|
RC213276L3 | Lenti ORF clone of Human paired related homeobox 1 (PRRX1), transcript variant pmx-1a, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC213276L4 | Lenti ORF clone of Human paired related homeobox 1 (PRRX1), transcript variant pmx-1a, mGFP tagged |
CNY 6,000.00 |
|
RG213276 | PRRX1 (tGFP-tagged) - Human paired related homeobox 1 (PRRX1), transcript variant pmx-1a |
CNY 5,200.00 |
|
SC303848 | PRRX1 (untagged)-Human paired related homeobox 1 (PRRX1), transcript variant pmx-1a |
CNY 3,600.00 |