GRB2 (NM_203506) Human Tagged ORF Clone
CAT#: RC213101
GRB2 (Myc-DDK-tagged)-Human growth factor receptor-bound protein 2 (GRB2), transcript variant 2
ORF Plasmid: tGFP
"NM_203506" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | ASH; EGFRBP-GRB2; Grb3-3; MST084; MSTP084; NCKAP2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC213101 representing NM_203506
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAAGCCATCGCCAAATATGACTTCAAAGCTACTGCAGACGACGAGCTGAGCTTCAAAAGGGGGGACA TCCTCAAGGTTTTGAACGAAGAATGTGATCAGAACTGGTACAAGGCAGAGCTTAATGGAAAAGACGGCTT CATTCCCAAGAACTACATAGAAATGAAACCACATCCGTTTGGAAACGATGTGCAGCACTTCAAGGTGCTC CGAGATGGAGCCGGGAAGTACTTCCTCTGGGTGGTGAAGTTCAATTCTTTGAATGAGCTGGTGGATTATC ACAGATCTACATCTGTCTCCAGAAACCAGCAGATATTCCTGCGGGACATAGAACAGGTGCCACAGCAGCC GACATACGTCCAGGCCCTCTTTGACTTTGATCCCCAGGAGGATGGAGAGCTGGGCTTCCGCCGGGGAGAT TTTATCCATGTCATGGATAACTCAGACCCCAACTGGTGGAAAGGAGCTTGCCACGGGCAGACCGGCATGT TTCCCCGCAATTATGTCACCCCCGTGAACCGGAACGTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC213101 representing NM_203506
Red=Cloning site Green=Tags(s) MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPFGNDVQHFKVL RDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGD FIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_203506 |
ORF Size | 528 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_203506.2, NP_987102.1 |
RefSeq Size | 3139 bp |
RefSeq ORF | 531 bp |
Locus ID | 2885 |
UniProt ID | P62993 |
Protein Families | Druggable Genome |
Protein Pathways | Acute myeloid leukemia, B cell receptor signaling pathway, Chemokine signaling pathway, Chronic myeloid leukemia, Colorectal cancer, Dorso-ventral axis formation, Endometrial cancer, ErbB signaling pathway, Fc epsilon RI signaling pathway, Focal adhesion, Gap junction, Glioma, GnRH signaling pathway, Insulin signaling pathway, Jak-STAT signaling pathway, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Non-small cell lung cancer, Pathways in cancer, Prostate cancer, Renal cell carcinoma, T cell receptor signaling pathway |
MW | 20.4 kDa |
Gene Summary | The protein encoded by this gene binds the epidermal growth factor receptor and contains one SH2 domain and two SH3 domains. Its two SH3 domains direct complex formation with proline-rich regions of other proteins, and its SH2 domain binds tyrosine phosphorylated sequences. This gene is similar to the Sem5 gene of C.elegans, which is involved in the signal transduction pathway. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC213101L1 | Lenti ORF clone of Human growth factor receptor-bound protein 2 (GRB2), transcript variant 2, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC213101L2 | Lenti ORF clone of Human growth factor receptor-bound protein 2 (GRB2), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RC213101L3 | Lenti ORF clone of Human growth factor receptor-bound protein 2 (GRB2), transcript variant 2, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC213101L4 | Lenti ORF clone of Human growth factor receptor-bound protein 2 (GRB2), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RG213101 | GRB2 (tGFP-tagged) - Human growth factor receptor-bound protein 2 (GRB2), transcript variant 2 |
CNY 4,370.00 |
|
SC308219 | GRB2 (untagged)-Human growth factor receptor-bound protein 2 (GRB2), transcript variant 2 |
CNY 2,400.00 |