United States
Germany
Japan
United Kingdom
China
PD-L1 (CD274) (NM_014143) Human Tagged ORF Clone
CAT＃: RC213071
PD-L1 / CD274 (Myc-DDK-tagged)-Human PD-L1 / CD274 molecule (PD-L1 / CD274)
ORF Plasmid: tGFP
"NM_014143" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,990.00
| Cited in 13 publications. |
Product images
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | B7-H; B7H1; hPD-L1; PD-L1; PDCD1L1; PDCD1LG1; PDL1 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC213071 representing NM_014143
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGGATATTTGCTGTCTTTATATTCATGACCTACTGGCATTTGCTGAACGCATTTACTGTCACGGTTC CCAAGGACCTATATGTGGTAGAGTATGGTAGCAATATGACAATTGAATGCAAATTCCCAGTAGAAAAACA ATTAGACCTGGCTGCACTAATTGTCTATTGGGAAATGGAGGATAAGAACATTATTCAATTTGTGCATGGA GAGGAAGACCTGAAGGTTCAGCATAGTAGCTACAGACAGAGGGCCCGGCTGTTGAAGGACCAGCTCTCCC TGGGAAATGCTGCACTTCAGATCACAGATGTGAAATTGCAGGATGCAGGGGTGTACCGCTGCATGATCAG CTATGGTGGTGCCGACTACAAGCGAATTACTGTGAAAGTCAATGCCCCATACAACAAAATCAACCAAAGA ATTTTGGTTGTGGATCCAGTCACCTCTGAACATGAACTGACATGTCAGGCTGAGGGCTACCCCAAGGCCG AAGTCATCTGGACAAGCAGTGACCATCAAGTCCTGAGTGGTAAGACCACCACCACCAATTCCAAGAGAGA GGAGAAGCTTTTCAATGTGACCAGCACACTGAGAATCAACACAACAACTAATGAGATTTTCTACTGCACT TTTAGGAGATTAGATCCTGAGGAAAACCATACAGCTGAATTGGTCATCCCAGAACTACCTCTGGCACATC CTCCAAATGAAAGGACTCACTTGGTAATTCTGGGAGCCATCTTATTATGCCTTGGTGTAGCACTGACATT CATCTTCCGTTTAAGAAAAGGGAGAATGATGGATGTGAAAAAATGTGGCATCCAAGATACAAACTCAAAG AAGCAAAGTGATACACATTTGGAGGAGACG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC213071 representing NM_014143
Red=Cloning site Green=Tags(s) MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHG EEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQR ILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCT FRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSK KQSDTHLEET myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_014143 |
| ORF Size | 870 bp |
| OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_014143.4 |
| RefSeq Size | 1553 bp |
| RefSeq ORF | 873 bp |
| Locus ID | 29126 |
| UniProt ID | Q9NZQ7 |
| Domains | ig, IG |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs) |
| MW | 33.28 kDa |
| Gene Summary | This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobulin V-like and C-like domains. Interaction of this ligand with its receptor inhibits T-cell activation and cytokine production. During infection or inflammation of normal tissue, this interaction is important for preventing autoimmunity by maintaining homeostasis of the immune response. In tumor microenvironments, this interaction provides an immune escape for tumor cells through cytotoxic T-cell inactivation. Expression of this gene in tumor cells is considered to be prognostic in many types of human malignancies, including colon cancer and renal cell carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015] |
Citations (13)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
BiTE-Secreting CAR-γδT as a Dual Targeting Strategy for the Treatment of Solid Tumors.
,null,
Advanced science (Weinheim, Baden-Wurttemberg, Germany)
,PubMed ID 37078788
[PD-L1]
|
|
BiTE‐Secreting CAR‐ γδ T as a Dual Targeting Strategy for the Treatment of Solid Tumors
,null,
Advanced Science
,PubMed ID 37078788
[PD-L1]
|
|
PD-L1 Is a Tumor Suppressor in Aggressive Endometrial Cancer Cells and Its Expression Is Regulated by miR-216a and lncRNA MEG3
,null,
Frontiers in Cell and Developmental Biology
,PubMed ID 33363153
[PD-L1]
|
|
PD-L1 glycosylation and its impact on binding to clinical antibodies
,Benicky, J;Sanda, M;Brnakova Kennedy, Z;Grant, O;Woods, R;Zwart, A;Goldman, R;,
bioRxiv
[PD-L1]
|
|
Regulation of sister chromatid cohesion by nuclear PD-L1
,Yu, J;Qin, B;Moyer, AM;Nowsheen, S;Tu, X;Dong, H;Boughey, JC;Goetz, MP;Weinshilboum, R;Lou, Z;Wang, L;,
Cell Res.
,PubMed ID 32350394
[PD-L1]
|
|
Bispecific antibody approach for improved melanoma-selective PD-L1 immune checkpoint blockade
,Koopmans, I;Hendriks, MAJM;van Ginkel, RJ;Samplonius, DF;Bremer, E;Helfrich, W;,
J. Invest. Dermatol.
,PubMed ID 31128201
[PD-L1]
|
|
Identification and characterization of an alternative cancer-derived PD-L1 splice variant
,Hassounah, NB;Malladi, VS;Huang, Y;Freeman, SS;Beauchamp, EM;Koyama, S;Souders, N;Martin, S;Dranoff, G;Wong, KK;Pedamallu, CS;Hammerman, PS;Akbay, EA;,
Cancer Immunol. Immunother.
,PubMed ID 30564890
[PD-L1]
|
|
Control of PD-L1 expression by miR-140/142/340/383 and oncogenic activation of the OCT4-miR-18a pathway in cervical cancer
,Dong, P;Xiong, Y;Yu, J;Chen, L;Tao, T;Yi, S;Hanley, SJB;Yue, J;Watari, H;Sakuragi, N;,
Oncogene
,PubMed ID 29855617
[PD-L1]
|
|
A novel bispecific antibody for EGFR-directed blockade of the PD-1/PD-L1 immune checkpoint
,Koopmans, I;Hendriks, D;Samplonius, D;van Ginkel, R;Heskamp, S;Wierstra, P;Bremer, E;Helfrich, W;,
OncoImmunology
[PD-L1]
|
|
Human CAR T cells with cell-intrinsic PD-1 checkpoint blockade resist tumor-mediated inhibition
,Cherkassky, L;Morello, A;Villena-Vargas, J;Feng, Y;Dimitrov, DS;Jones, DR;Sadelain, M;Adusumilli, PS;,
J. Clin. Invest.
,PubMed ID 27454297
[PD-L1]
|
|
Selection and characterization of the novel anti-human PD-1 FV78 antibody from a targeted epitope mammalian cell-displayed antibody library
,Luo, L;Wang, S;Lang, X;Zhou, T;Geng, J;Li, X;Qiao, C;Feng, J;Shen, B;Lv, M;Li, Y;,
Cell. Mol. Immunol.
,PubMed ID 27499043
[PD-L1]
|
|
The tumor suppressor miR-138-5p targets PD-L1 in colorectal cancer
,Zhao, L;Yu, H;Yi, S;Peng, X;Su, P;Xiao, Z;Liu, R;Tang, A;Li, X;Liu, F;Shen, S;,
Oncotarget
,PubMed ID 27248318
[PD-L1]
|
|
Tumor Cell Programmed Death Ligand 1-Mediated T Cell Suppression Is Overcome by Coexpression of CD80
,Samuel T. Haile, Jacobus J. Bosch, Nnenna I. Agu, Annette M. Zeender, Preethi Somasundaram, Minu K. Srivastava, Sabine Britting, Julie B. Wolf, Bruce R. Ksander, and Suzanne Ostrand-Rosenberg,
J. Immunol., Jun 2011; 186: 6822 - 6829
[PD-L1]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC213071L1 | Lenti ORF clone of Human CD274 molecule (CD274), Myc-DDK-tagged |
CNY 4,800.00 |
|
| RC213071L2 | Lenti ORF clone of Human CD274 molecule (CD274), mGFP tagged |
CNY 4,800.00 |
|
| RC213071L3 | Lenti ORF clone of Human CD274 molecule (CD274), Myc-DDK-tagged |
CNY 4,800.00 |
|
| RC213071L4 | Lenti ORF clone of Human CD274 molecule (CD274), mGFP tagged |
CNY 4,800.00 |
|
| RG213071 | PD-L1 / CD274 (tGFP-tagged) - Human PD-L1 / CD274 molecule (PD-L1 / CD274) |
CNY 4,000.00 |
|
| SC115168 | PD-L1 / CD274 (untagged)-Human PD-L1 / CD274 molecule (PD-L1 / CD274) |
CNY 3,600.00 |
