ROMO1 (NM_080748) Human Tagged ORF Clone
CAT#: RC210655
ROMO1 (Myc-DDK-tagged)-Human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein
ORF Plasmid: tGFP
"NM_080748" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | bA353C18.2; C20orf52; MTGM; MTGMP |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC210655 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCGGTGGCCGTGGGTCCCTACGGACAGTCCCAGCCAAGCTGCTTCGACCGTGTCAAAATGGGCTTCG TGATGGGTTGCGCCGTGGGCATGGCGGCCGGGGCGCTCTTCGGCACCTTTTCCTGTCTCAGGATCGGAAT GCGGGGTCGAGAGCTGATGGGCGGCATTGGGAAAACCATGATGCAGAGTGGCGGCACCTTTGGCACATTC ATGGCCATTGGGATGGGCATCCGATGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC210655 protein sequence
Red=Cloning site Green=Tags(s) MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTF MAIGMGIRC myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_080748 |
ORF Size | 237 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_080748.3 |
RefSeq Size | 477 bp |
RefSeq ORF | 240 bp |
Locus ID | 140823 |
UniProt ID | P60602 |
Protein Families | Transmembrane |
MW | 8.2 kDa |
Gene Summary | The protein encoded by this gene is a mitochondrial membrane protein that is responsible for increasing the level of reactive oxygen species (ROS) in cells. The protein also has antimicrobial activity against a variety of bacteria by inducing bacterial membrane breakage. [provided by RefSeq, Nov 2014] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC210655L1 | Lenti ORF clone of Human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC210655L2 | Lenti ORF clone of Human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein, mGFP tagged |
CNY 5,890.00 |
|
RC210655L3 | Lenti ORF clone of Human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC210655L4 | Lenti ORF clone of Human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein, mGFP tagged |
CNY 5,890.00 |
|
RG210655 | ROMO1 (tGFP-tagged) - Human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein |
CNY 2,800.00 |
|
SC120357 | ROMO1 (untagged)-Human reactive oxygen species modulator 1 (ROMO1), nuclear gene encoding mitochondrial protein |
CNY 1,200.00 |