CITED4 (NM_133467) Human Tagged ORF Clone

CAT#: RC208620

CITED4 (Myc-DDK-tagged)-Human Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4 (CITED4)

ORF Plasmid: DDK tGFP



  "NM_133467" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

CNY 3,600.00

CNY 5,130.00


货期*
现货

规格
    • 10 ug

Cited in 1 publication.

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Rabbit monoclonal antibody against CITED4(clone EPR2702)
    • 100 ul

CNY 5,236.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208620 representing NM_133467
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGACCACCTGATGCTCGCCGAGGGCTACCGCCTGGTGCAGAGGCCGCCGTCCGCCGCGGCCGCCC
ATGGCCCTCATGCGCTCCGGACTCTGCCGCCGTACGCGGGCCCGGGCCTGGACAGTGGGCTGAGGCCGCG
GGGGGCTCCGCTGGGGCCGCCGCCGCCCCGCCAACCCGGGGCCCTGGCGTACGGGGCCTTCGGGCCGCCG
TCCTCCTTCCAGCCCTTTCCGGCCGTGCCTCCGCCGGCCGCGGGCATCGCGCACCTGCAGCCTGTGGCGA
CGCCGTACCCCGGCCGCGCGGCCGCGCCCCCCAACGCTCCGGGAGGCCCCCCGGGCCCGCAGCCGGCGCC
AAGCGCCGCAGCCCCGCCGCCGCCCGCGCACGCCCTGGGCGGCATGGACGCCGAACTCATCGACGAGGAG
GCGCTGACGTCGCTGGAGCTGGAGCTCGGGCTGCACCGCGTGCGCGAGCTGCCCGAGCTCTTCCTGGGCC
AGAGCGAGTTCGACTGCTTCTCGGACTTGGGGTCCGCGCCGCCCGCCGGCTCCGTGAGCTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208620 representing NM_133467
Red=Cloning site Green=Tags(s)

MADHLMLAEGYRLVQRPPSAAAAHGPHALRTLPPYAGPGLDSGLRPRGAPLGPPPPRQPGALAYGAFGPP
SSFQPFPAVPPPAAGIAHLQPVATPYPGRAAAPPNAPGGPPGPQPAPSAAAPPPPAHALGGMDAELIDEE
ALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_133467
ORF Size 552 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_133467.3
RefSeq Size 1312 bp
RefSeq ORF 555 bp
Locus ID 163732
UniProt ID Q96RK1
Protein Families Transcription Factors
MW 18.4 kDa
Gene Summary The protein encoded by this intronless gene belongs to the CITED family of transcriptional coactivators that bind to several proteins, including CREB-binding protein (CBP) and p300, via a conserved 32 aa C-terminal motif, and regulate gene transcription. This protein also interacts with transcription factor AP2 (TFAP2), and thus may function as a co-activator for TFAP2. Hypermethylation and transcriptional downregulation of this gene has been observed in oligodendroglial tumors with deletions of chromosomal arms 1p and 19q, and associated with longer recurrence-free and overall survival of patients with oligodendroglial tumors. [provided by RefSeq, Aug 2011]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Other Versions

Customer Reviews 
Loading...