United States
Germany
Japan
United Kingdom
China
BST2 (NM_004335) Human Tagged ORF Clone
CAT＃: RC207540
BST2 (Myc-DDK-tagged)-Human bone marrow stromal cell antigen 2 (BST2)
ORF Plasmid: tGFP
"NM_004335" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
| Cited in 5 publications. |
Product images
CNY 300.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | CD317; HM1.24; TETHERIN |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC207540 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCATCTACTTCGTATGACTATTGCAGAGTGCCCATGGAAGACGGGGATAAGCGCTGTAAGCTTCTGC TGGGGATAGGAATTCTGGTGCTCCTGATCATCGTGATTCTGGGGGTGCCCTTGATTATCTTCACCATCAA GGCCAACAGCGAGGCCTGCCGGGACGGCCTTCGGGCAGTGATGGAGTGTCGCAATGTCACCCATCTCCTG CAACAAGAGCTGACCGAGGCCCAGAAGGGCTTTCAGGATGTGGAGGCCCAGGCCGCCACCTGCAACCACA CTGTGATGGCCCTAATGGCTTCCCTGGATGCAGAGAAGGCCCAAGGACAAAAGAAAGTGGAGGAGCTTGA GGGAGAGATCACTACATTAAACCATAAGCTTCAGGACGCGTCTGCAGAGGTGGAGCGACTGAGAAGAGAA AACCAGGTCTTAAGCGTGAGAATCGCGGACAAGAAGTACTACCCCAGCTCCCAGGACTCCAGCTCCGCTG CGGCGCCCCAGCTGCTGATTGTGCTGCTGGGCCTCAGCGCTCTGCTGCAG AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC TGGATTACAAGGATGACGACGATAAGGTTTAA >RC207540 protein sequence
Red=Cloning site Green=Tags(s) MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLL QQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRE NQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-RsrII
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_004335 |
| ORF Size | 540 bp |
| OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_004335.4 |
| RefSeq Size | 1048 bp |
| RefSeq ORF | 543 bp |
| Locus ID | 684 |
| UniProt ID | Q10589 |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
| MW | 19.8 kDa |
| Gene Summary | Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis. [provided by RefSeq, Jul 2008] |
Citations (5)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
Sphingolipid subtypes differentially control proinsulin processing and systemic glucose homeostasis
,null,
Nature Cell Biology
,PubMed ID 36543979
[BST2]
|
|
Japanese encephalitis virus counteracts BST2 restriction via its envelope protein E
,Li, M;Wang, P;Zheng, Z;Hu, K;Zhang, M;Guan, X;Fu, M;Zhang, D;Wang, W;Xiao, G;Hu, Q;Liu, Y;,
Virology
,PubMed ID 28710958
[BST2]
|
|
HSV-2 glycoprotein gD targets the CC domain of tetherin and promotes tetherin degradation via lysosomal pathway
,Liu, Y;Li, M;Zhang, D;Zhang, M;Hu, Q;,
Virol. J.
,PubMed ID 27630089
[BST2]
|
|
Ebola Virus Glycoprotein Counteracts BST-2/Tetherin Restriction in a Sequence-Independent Manner That Does Not Require Tetherin Surface Removal
,Lisa A. Lopez, Su Jung Yang, Heiko Hauser, Colin M. Exline, Kevin G. Haworth, Jill Oldenburg, and Paula M. Cannon,
J. Virol., Jul 2010; 84: 7243 - 7255.
[BST2]
|
|
Ebola glycoprotein counteracts BST-2/tetherin restriction in a sequence independent manner that does not require tetherin surface removal
,Lisa A. Lopez, Su Jung Yang, Heiko Hauser, Colin M. Exline, Kevin G. Haworth, Jill Oldenburg, and Paula M. Cannon,
J. Virol., May 2010; 10.1128/JVI.02636-09
[BST2]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC207540L1 | Lenti ORF clone of Human bone marrow stromal cell antigen 2 (BST2), Myc-DDK-tagged |
CNY 6,000.00 |
|
| RC207540L2 | Lenti ORF clone of Human bone marrow stromal cell antigen 2 (BST2), mGFP tagged |
CNY 5,890.00 |
|
| RC207540L3 | Lenti ORF clone of Human bone marrow stromal cell antigen 2 (BST2), Myc-DDK-tagged |
CNY 5,890.00 |
|
| RC207540L4 | Lenti ORF clone of Human bone marrow stromal cell antigen 2 (BST2), mGFP tagged |
CNY 6,000.00 |
|
| RG207540 | BST2 (tGFP-tagged) - Human bone marrow stromal cell antigen 2 (BST2) |
CNY 5,200.00 |
|
| SC117439 | BST2 (untagged)-Human bone marrow stromal cell antigen 2 (BST2) |
CNY 3,600.00 |
