ARL4 (ARL4A) (NM_001037164) Human Tagged ORF Clone

CAT#: RC207296

ARL4A (Myc-DDK-tagged)-Human ADP-ribosylation factor-like 4A (ARL4A), transcript variant 3

ORF Plasmid: DDK tGFP



  "NM_001037164" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 2,400.00

CNY 3,705.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


ARL4A mouse monoclonal antibody,clone OTI2A5
    • 100 ul

CNY 1,999.00
CNY 2,700.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms ARL4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC207296 representing NM_001037164
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAATGGGCTGTCAGACCAGACTTCTATCCTGTCCAACCTGCCTTCATTTCAGTCTTTCCACATTG
TTATTCTGGGTTTGGACTGTGCTGGAAAGACAACTGTCTTATACAGGCTGCAGTTCAATGAATTTGTAAA
TACCGTACCTACCAAAGGATTTAACACTGAGAAAATTAAGGTAACCTTGGGAAATTCTAAAACAGTCACT
TTTCACTTCTGGGATGTAGGTGGTCAGGAGAAATTAAGGCCACTGTGGAAGTCATATACCAGATGCACAG
ATGGCATTGTATTTGTTGTGGACTCTGTTGATGTCGAAAGGATGGAAGAAGCCAAAACTGAACTTCACAA
AATAACTAGGATATCAGAAAATCAGGGAGTCCCTGTACTTATAGTTGCTAACAAACAAGATTTGAGGAAC
TCATTGTCACTTTCAGAAATTGAGAAATTGTTAGCAATGGGTGAACTGAGCTCATCAACTCCTTGGCATT
TGCAGCCTACCTGTGCAATCATAGGAGATGGCCTAAAGGAAGGACTTGAGAAACTACATGATATGATCAT
TAAAAGAAGAAAAATGTTGCGGCAACAGAAAAAGAAAAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC207296 representing NM_001037164
Red=Cloning site Green=Tags(s)

MGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVT
FHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRN
SLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001037164
ORF Size 600 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_001037164.2, NP_001032241.1
RefSeq Size 2957 bp
RefSeq ORF 603 bp
Locus ID 10124
UniProt ID P40617
Protein Families Stem cell - Pluripotency
MW 22.4 kDa
Gene Summary ADP-ribosylation factor-like 4A is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4A is similar to ARL4C and ARL4D and each has a nuclear localization signal and an unusually high guaninine nucleotide exchange rate. ARL4A is located in both the nuclear and extranuclear cell compartments. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...