PRRX2 (NM_016307) Human Tagged ORF Clone

CAT#: RC204075

  • TrueORF®

PRRX2 (Myc-DDK-tagged)-Human paired related homeobox 2 (PRRX2)

ORF Plasmid: DDK tGFP



  "NM_016307" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 2,400.00

CNY 3,990.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Rabbit Polyclonal Anti-PRRX2 Antibody - middle region
    • 50 ug

CNY 4,628.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms PMX2; PRX2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204075 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACAGCGCGGCCGCCGCCTTCGCCCTGGACAAGCCGGCGCTGGGCCCGGGGCCGCCGCCGCCTCCAC
CCGCGCTGGGGCCCGGCGACTGCGCCCAGGCGCGCAAGAACTTCTCGGTGAGCCACCTCCTGGACCTGGA
AGAGGTGGCGGCGGCCGGGCGGCTGGCGGCGCGCCCCGGGGCCAGGGCCGAGGCGCGGGAGGGCGCAGCA
CGGGAGCCGTCCGGGGGCAGCAGCGGCAGCGAGGCGGCGCCGCAGGATGGTGAGTGTCCCAGCCCGGGGC
GCGGTAGCGCCGCCAAGCGGAAGAAGAAGCAGCGGCGGAACCGCACCACGTTCAACAGCAGCCAACTGCA
GGCGCTGGAGCGCGTGTTCGAGCGCACGCACTACCCCGACGCCTTTGTGCGCGAGGAGCTTGCCCGGCGC
GTCAACCTCAGCGAGGCGCGCGTTCAGGTCTGGTTTCAGAACCGCCGCGCCAAGTTCCGCAGGAATGAAA
GGGCCATGCTGGCCAGCCGCTCTGCCTCGCTGCTCAAGTCCTACAGCCAGGAGGCCGCCATCGAGCAGCC
CGTGGCTCCCCGGCCCACCGCCCTGAGTCCAGATTATCTCTCCTGGACAGCCTCGTCCCCCTACAGCACA
GTGCCACCCTACAGCCCTGGGAGCTCAGGCCCCGCAACCCCAGGGGTCAACATGGCCAACAGCATCGCCA
GCCTCCGTCTCAAGGCCAAGGAGTTCAGCCTGCACCACAGCCAGGTGCCTACGGTGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204075 protein sequence
Red=Cloning site Green=Tags(s)

MDSAAAAFALDKPALGPGPPPPPPALGPGDCAQARKNFSVSHLLDLEEVAAAGRLAARPGARAEAREGAA
REPSGGSSGSEAAPQDGECPSPGRGSAAKRKKKQRRNRTTFNSSQLQALERVFERTHYPDAFVREELARR
VNLSEARVQVWFQNRRAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSWTASSPYST
VPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_016307
ORF Size 759 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016307.4
RefSeq Size 1327 bp
RefSeq ORF 762 bp
Locus ID 51450
UniProt ID Q99811
Protein Families Transcription Factors
MW 27.1 kDa
Gene Summary The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins. Expression is localized to proliferating fetal fibroblasts and the developing dermal layer, with downregulated expression in adult skin. Increases in expression of this gene during fetal but not adult wound healing suggest a possible role in mechanisms that control mammalian dermal regeneration and prevent formation of scar response to wounding. The expression patterns provide evidence consistent with a role in fetal skin development and a possible role in cellular proliferation. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...