SIVA (SIVA1) (NM_021709) Human Tagged ORF Clone
CAT#: RC203748
SIVA1 (Myc-DDK-tagged)-Human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 2
ORF Plasmid: tGFP
"NM_021709" in other vectors (7)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CD27BP; SIVA; Siva-1; Siva-2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC203748 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCCAAGCGGAGCTGCCCCTTCGCGGACGTGGCCCCGCTACAGCTCAAGGTCCGCGTGAGCCAGAGGG AGTTGAGCCGCGGCGTGTGCGCCGAGCGCTACTCGCAGGAGGTCTTCGACCCATCTGGGGTAGCGTCCAT TGCCTGTTCCTCATGCGTGCGAGCCGTGGATGGGAAGGCGGTCTGCGGTCAGTGTGAGCGAGCCCTGTGC GGGCAGTGTGTGCGCACCTGCTGGGGCTGCGGCTCCGTGGCCTGTACCCTGTGTGGCCTCGTGGACTGCA GTGACATGTACGAGAAAGTGCTGTGCACCAGCTGTGCCATGTTCGAGACC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC203748 protein sequence
Red=Cloning site Green=Tags(s) MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALC GQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_021709 |
ORF Size | 330 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_021709.3 |
RefSeq Size | 595 bp |
RefSeq ORF | 333 bp |
Locus ID | 10572 |
UniProt ID | O15304 |
Protein Families | Druggable Genome |
MW | 11.8 kDa |
Gene Summary | This gene encodes an E3 ubiquitin ligase that regulates cell cycle progression, cell proliferation and apoptosis. The N-terminus of this protein binds to the cytoplasmic tail of the CD27 antigen, a member of the tumor necrosis factor receptor (TNFR) superfamily. In response to UV radiation-induced DNA damage, this protein has been shown to mediate the ubiquitination of proliferating cell nuclear antigen (PCNA), an important step in translesion DNA synthesis. [provided by RefSeq, Sep 2018] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC203748L1 | Lenti ORF clone of Human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 2, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC203748L2 | Lenti ORF clone of Human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RC203748L3 | Lenti ORF clone of Human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 2, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC203748L4 | Lenti ORF clone of Human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RG203748 | SIVA1 (tGFP-tagged) - Human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 2 |
CNY 2,800.00 |
|
SC110171 | SIVA1 (untagged)-Human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 2 |
CNY 3,990.00 |
|
SC323987 | SIVA1 (untagged)-Human SIVA1, apoptosis-inducing factor (SIVA1), transcript variant 2 |
CNY 1,200.00 |