HMGA1 (NM_145899) Human Tagged ORF Clone
CAT#: RC202928
HMGA1 (Myc-DDK-tagged)-Human high mobility group AT-hook 1 (HMGA1), transcript variant 1
ORF Plasmid: tGFP
"NM_145899" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | HMG-R; HMGA1A; HMGIY |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC202928 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGTGAGTCGAGCTCGAAGTCCAGCCAGCCCTTGGCCTCCAAGCAGGAAAAGGACGGCACTGAGAAGC GGGGCCGGGGCAGGCCGCGCAAGCAGCCTCCGGTGAGTCCCGGGACAGCGCTGGTAGGGAGTCAGAAGGA GCCCAGCGAAGTGCCAACACCTAAGAGACCTCGGGGCCGACCAAAGGGAAGCAAAAACAAGGGTGCTGCC AAGACCCGGAAAACCACCACAACTCCAGGAAGGAAACCAAGGGGCAGACCCAAAAAACTGGAGAAGGAGG AAGAGGAGGGCATCTCGCAGGAGTCCTCGGAGGAGGAGCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202928 protein sequence
Red=Cloning site Green=Tags(s) MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAA KTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_145899 |
ORF Size | 321 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_145899.3 |
RefSeq Size | 2031 bp |
RefSeq ORF | 324 bp |
Locus ID | 3159 |
UniProt ID | P17096 |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors |
MW | 11.7 kDa |
Gene Summary | This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes. [provided by RefSeq, Jan 2016] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
HMGA1/E2F1 axis and NFkB pathways regulate LPS progression and trabectedin resistance
,Loria, R;Laquintana, V;Bon, G;Trisciuoglio, D;Frapolli, R;Covello, R;Amoreo, CA;Ferraresi, V;Zoccali, C;Novello, M;Del Bufalo, D;Milella, M;Biagini, R;D'Incalci, M;Falcioni, R;,
Oncogene
,PubMed ID 29980789
[HMGA1]
|
Quantitative proteomics reveals the roles of peroxisome-associated proteins in anti-viral innate immune responses
,Zhou, MT;Qin, Y;Li, M;Chen, C;Chen, X;Shu, HB;Guo, L;,
Mol. Cell Proteomics
,PubMed ID 26124285
[HMGA1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC202928L1 | Lenti ORF clone of Human high mobility group AT-hook 1 (HMGA1), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC202928L2 | Lenti ORF clone of Human high mobility group AT-hook 1 (HMGA1), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC202928L3 | Lenti ORF clone of Human high mobility group AT-hook 1 (HMGA1), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC202928L4 | Lenti ORF clone of Human high mobility group AT-hook 1 (HMGA1), transcript variant 1, mGFP tagged |
CNY 3,600.00 |
|
RG202928 | HMGA1 (tGFP-tagged) - Human high mobility group AT-hook 1 (HMGA1), transcript variant 1 |
CNY 2,800.00 |
|
SC319124 | HMGA1 (untagged)-Human high mobility group AT-hook 1 (HMGA1), transcript variant 1 |
CNY 1,200.00 |