United States
Germany
Japan
United Kingdom
China
Serum Amyloid A (SAA1) (NM_199161) Human Tagged ORF Clone
CAT＃: RC202738
SAA1 (Myc-DDK-tagged)-Human serum amyloid A1 (SAA1), transcript variant 2
ORF Plasmid: tGFP
"NM_199161" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
| Cited in 1 publication. |
Product images
CNY 300.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | PIG4; SAA; SAA2; TP53I4 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC202738 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAGCTTCTCACGGGCCTGGTTTTCTGCTCCTTGGTCCTGGGTGTCAGCAGCCGAAGCTTCTTTTCGT TCCTTGGCGAGGCTTTTGATGGGGCTCGGGACATGTGGAGAGCCTACTCTGACATGAGAGAAGCCAATTA CATCGGCTCAGACAAATACTTCCATGCTCGGGGGAACTATGATGCTGCCAAAAGGGGACCTGGGGGTGTC TGGGCTGCAGAAGCGATCAGCGATGCCAGAGAGAATATCCAGAGATTCTTTGGCCATGGTGCGGAGGACT CACTGGCCGATCAGGCTGCCGATGAATGGGGCAGGAGTGGCAAAGACCCCAATCACTTCCGACCTGCTGG CCTGCCTGAGAAATAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202738 protein sequence
Red=Cloning site Green=Tags(s) MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGV WAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_199161 |
| ORF Size | 366 bp |
| OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_199161.5 |
| RefSeq Size | 531 bp |
| RefSeq ORF | 369 bp |
| Locus ID | 6288 |
| UniProt ID | P02735 |
| MW | 13.5 kDa |
| Gene Summary | This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimer's disease and Crohn's disease. This protein may also be a potential biomarker for certain tumors. Finally, antimicrobial activity against S. aureus and E. coli resides in the N-terminal portion of the mature protein. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11. [provided by RefSeq, Jul 2020] |
Citations (1)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
Serum Amyloid A is a Soluble Pattern Recognition Receptor that Drives Type 2 Immunity
,null,
Nature immunology
,PubMed ID 32572240
[Serum Amyloid A]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC202738L1 | Lenti ORF clone of Human serum amyloid A1 (SAA1), transcript variant 2, Myc-DDK-tagged |
CNY 3,600.00 |
|
| RC202738L2 | Lenti ORF clone of Human serum amyloid A1 (SAA1), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
| RC202738L3 | Lenti ORF clone of Human serum amyloid A1 (SAA1), transcript variant 2, Myc-DDK-tagged |
CNY 5,890.00 |
|
| RC202738L4 | Lenti ORF clone of Human serum amyloid A1 (SAA1), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
| RG202738 | SAA1 (tGFP-tagged) - Human serum amyloid A1 (SAA1), transcript variant 2 |
CNY 2,800.00 |
|
| SC324416 | SAA1 (untagged)-Human serum amyloid A1 (SAA1), transcript variant 2 |
CNY 1,200.00 |
其它Serum Amyloid A产品
