PAR4 (PAWR) (NM_002583) Human Tagged ORF Clone
CAT#: RC202733
PAWR (Myc-DDK-tagged)-Human PRKC, apoptosis, WT1, regulator (PAWR)
ORF Plasmid: tGFP
"NM_002583" in other vectors (7)
Need custom modification / cloning service?
Get a free quote
CNY 3,656.00
CNY 3,990.00
Cited in 10 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | Par-4; PAR4 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC202733 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGACCGGTGGCTACCGGACCAGCAGCGGCCTCGGCGGCAGCACCACAGACTTCCTGGAGGAGTGGA AGGCGAAACGCGAGAAGATGCGCGCCAAGCAGAACCCCCCGGGCCCGGCCCCCCCGGGAGGGGGCAGCAG CGACGCCGCTGGGAAGCCCCCCGCGGGGGCTCTGGGCACCCCGGCGGCCGCCGCTGCCAACGAGCTCAAC AACAACCTCCCGGGCGGCGCGCCGGCCGCACCTGCCGTCCCCGGTCCCGGGGGCGTGAACTGCGCGGTCG GCTCCGCCATGCTGACGCGGGCGGCCCCCGGCCCGCGGCGGTCGGAGGACGAGCCCCCAGCCGCCTCTGC CTCGGCTGCACCGCCGCCCCAGCGTGACGAGGAGGAGCCGGACGGCGTCCCAGAGAAGGGCAAGAGCTCG GGCCCCAGTGCCAGGAAAGGCAAGGGGCAGATCGAGAAGAGGAAGCTGCGGGAGAAGCGGCGCTCCACCG GCGTGGTCAACATCCCTGCCGCAGAGTGCTTAGATGAGTACGAAGATGATGAAGCAGGGCAGAAAGAGCG GAAACGAGAAGATGCAATTACACAACAGAACACTATACAGAATGAAGCTGTAAACTTACTAGATCCAGGC AGTTCCTATCTGCTACAGGAGCCACCTAGAACAGTTTCAGGCAGATATAAAAGCACAACCAGTGTCTCTG AAGAAGATGTCTCAAGTAGATATTCTCGAACAGATAGAAGTGGGTTCCCTAGATATAACAGGGATGCAAA TGTTTCAGGTACTCTGGTTTCAAGTAGCACACTGGAAAAGAAAATTGAAGATCTTGAAAAGGAAGTAGTA AGAGAAAGACAAGAAAACCTAAGACTTGTGAGACTGATGCAAGATAAAGAGGAAATGATTGGAAAACTCA AAGAAGAAATTGATTTATTAAATAGAGACCTAGATGACATAGAAGATGAAAATGAACAGCTAAAGCAGGA AAATAAAACTCTTTTGAAAGTTGTGGGTCAGCTGACCAGG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202733 protein sequence
Red=Cloning site Green=Tags(s) MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELN NNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSS GPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPG SSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVV RERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_002583 |
ORF Size | 1020 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002583.4 |
RefSeq Size | 1967 bp |
RefSeq ORF | 1023 bp |
Locus ID | 5074 |
UniProt ID | Q96IZ0 |
Protein Families | Druggable Genome, Transcription Factors |
MW | 36.6 kDa |
Gene Summary | This gene encodes a tumor suppressor protein that selectively induces apoptosis in cancer cells through intracellular and extracellular mechanisms. The intracellular mechanism involves the inhibition of pro-survival pathways and the activation of Fas-mediated apoptosis, while the extracellular mechanism involves the binding of a secreted form of this protein to glucose regulated protein 78 (GRP78) on the cell surface, which leads to activation of the extrinsic apoptotic pathway. This gene is located on the unstable human chromosomal 12q21 region and is often deleted or mutated different tumors. The encoded protein also plays an important role in the progression of age-related diseases. [provided by RefSeq, Aug 2017] |
Citations (10)
The use of this cDNA Clones has been cited in the following citations: |
---|
Par-4 regulates autophagic cell death in human cancer cells via upregulating p53 and BNIP3.
,null,
Biochimica et biophysica acta. Molecular cell research
,PubMed ID 32135176
[PAR4]
|
Critical role of H2O2 in mediating sanguinarine-induced apoptosis in prostate cancer cells via facilitating ceramide generation, ERK1/2 phosphorylation, and Par-4 cleavage.
,null,
Free radical biology medicine
,PubMed ID 30735839
[PAR4]
|
Par-4-dependent p53 up-regulation plays a critical role in thymoquinone-induced cellular senescence in human malignant glioma cells
,Subburayan, K;Thayyullathil, F;Pallichankandy, S;Rahman, A;Galadari, S;,
Cancer Lett.
,PubMed ID 29656006
[PAR4]
|
TRIM21 is a novel regulator of Par-4 in colon and pancreatic cancer cells
,Nguyen, JQ;Irby, RB;,
Cancer Biol. Ther.
,PubMed ID 27830973
[PAR4]
|
ROS-dependent prostate apoptosis response-4 (Par-4) up-regulation and ceramide generation are the prime signaling events associated with curcumin-induced autophagic cell death in human malignant glioma
,null,
FEBS Open Bio
,PubMed ID 25349781
[PAR4]
|
ROS-dependent prostate apoptosis response-4 (Par-4) up-regulation and ceramide generation are the prime signaling events associated with curcumin-induced autophagic cell death in human malignant glioma
,Thayyullathil, F;Rahman, A;Pallichankandy, S;Patel, M;,
FEBS Open Bio
[PAR4]
|
Prostate apoptosis response-4 mediates TGF-β-induced epithelial-to-mesenchymal transition
,Chaudhry, P;Fabi, F;Singh, M;Parent, S;Leblanc, V;Asselin, E;,
Cell Death Dis, Feb 2014.
,PubMed ID 24503536
[PAR4]
|
Caspase-3 mediated release of SAC domain containing fragment from Par-4 is necessary for the sphingosine-induced apoptosis in Jurkat cells
,null,
Journal of Molecular Signaling
,PubMed ID 23442976
[PAR4]
|
Prostate Apoptosis Response 4 (Par-4), a Novel Substrate of Caspase-3 during Apoptosis Activation
,Parvesh Chaudhry, Mohan Singh, Sophie Parent, and Eric Asselin,
Mol. Cell. Biol., Feb 2012; 32: 826 - 839.
[PAR4]
|
The Akt Inhibitor ISC-4 Activates Prostate Apoptosis Response Protein-4 and Reduces Colon Tumor Growth in a Nude Mouse Model
,Arun K. Sharma, Christina L. Kline, Arthur Berg, Shantu Amin, and Rosalyn B. Irby,
Clin. Cancer Res., Jul 2011; 17: 4474 - 4483.
[PAR4]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC202733L1 | Lenti ORF clone of Human PRKC, apoptosis, WT1, regulator (PAWR), Myc-DDK-tagged |
CNY 6,056.00 |
|
RC202733L2 | Lenti ORF clone of Human PRKC, apoptosis, WT1, regulator (PAWR), mGFP tagged |
CNY 5,890.00 |
|
RC202733L3 | Lenti ORF clone of Human PRKC, apoptosis, WT1, regulator (PAWR), Myc-DDK-tagged |
CNY 6,056.00 |
|
RC202733L4 | Lenti ORF clone of Human PRKC, apoptosis, WT1, regulator (PAWR), mGFP tagged |
CNY 6,056.00 |
|
RG202733 | PAWR (tGFP-tagged) - Human PRKC, apoptosis, WT1, regulator (PAWR) |
CNY 5,256.00 |
|
SC110969 | PAWR (untagged)-Human PRKC, apoptosis, WT1, regulator (PAWR) |
CNY 3,656.00 |
|
SC320836 | PAWR (untagged)-Human PRKC, apoptosis, WT1, regulator (PAWR) |
CNY 3,656.00 |