Histone H2A.X (H2AFX) (NM_002105) Human Tagged ORF Clone
CAT#: RC201434
H2AFX (Myc-DDK-tagged)-Human H2A histone family, member X (H2AFX)
ORF Plasmid: tGFP
"NM_002105" in other vectors (7)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
CNY 1,999.00
CNY 4,070.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | H2A.X; H2A/X; H2AFX |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC201434 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCGGGCCGCGGCAAGACTGGCGGCAAGGCCCGCGCCAAGGCCAAGTCGCGCTCGTCGCGCGCCGGCC TCCAGTTCCCAGTGGGCCGTGTACACCGGCTGCTGCGGAAGGGCCACTACGCCGAGCGCGTTGGCGCCGG CGCGCCAGTGTACCTGGCGGCAGTGCTGGAGTACCTCACCGCTGAGATCCTGGAGCTGGCGGGCAATGCG GCCCGCGACAACAAGAAGACGCGAATCATCCCCCGCCACCTGCAGCTGGCCATCCGCAACGACGAGGAGC TCAACAAGCTGCTGGGCGGCGTGACGATCGCCCAGGGAGGCGTCCTGCCCAACATCCAGGCCGTGCTGCT GCCCAAGAAGACCAGCGCCACCGTGGGGCCGAAGGCGCCCTCGGGCGGCAAGAAGGCCACCCAGGCCTCC CAGGAGTAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC201434 protein sequence
Red=Cloning site Green=Tags(s) MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNA ARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQAS QEY myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002105 |
ORF Size | 429 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_002105.3 |
RefSeq Size | 1651 bp |
RefSeq ORF | 432 bp |
Locus ID | 3014 |
UniProt ID | P16104 |
Domains | H2A, histone |
Protein Families | Druggable Genome |
Protein Pathways | Systemic lupus erythematosus |
MW | 15.1 kDa |
Gene Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-independent histone that is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. [provided by RefSeq, Oct 2015] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Aspartate β-hydroxylase disrupts mitochondrial DNA stability and function in hepatocellular carcinoma
,Tang, C;Hou, Y;Wang, H;Wang, K;Xiang, H;Wan, X;Xia, Y;Li, J;Wei, W;Xu, S;Lei, Z;Pawlik, TM;Wang, H;Wu, M;Shen, F;,
Oncogenesis
,PubMed ID 28714949
[Histone H2A.X]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC201434L1 | Lenti ORF clone of Human H2A histone family, member X (H2AFX), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC201434L2 | Lenti ORF clone of Human H2A histone family, member X (H2AFX), mGFP tagged |
CNY 5,890.00 |
|
RC201434L3 | Lenti ORF clone of Human H2A histone family, member X (H2AFX), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC201434L4 | Lenti ORF clone of Human H2A histone family, member X (H2AFX), mGFP tagged |
CNY 5,890.00 |
|
RG201434 | H2AFX (tGFP-tagged) - Human H2A histone family, member X (H2AFX) |
CNY 2,800.00 |
|
SC125294 | H2AFX (untagged)-Human H2A histone family, member X (H2AFX) |
CNY 1,200.00 |
|
SC320322 | H2AFX (untagged)-Human H2A histone family, member X (H2AFX) |
CNY 1,200.00 |
其它Histone H2A.X产品