HSBP1 (NM_001537) Human Tagged ORF Clone
CAT#: RC201399
HSBP1 (Myc-DDK-tagged)-Human heat shock factor binding protein 1 (HSBP1)
ORF Plasmid: tGFP
"NM_001537" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | NPC-A-13 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC201399 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCGAGACTGACCCCAAGACCGTGCAGGACCTCACCTCGGTGGTGCAGACACTCCTGCAGCAGATGC AAGATAAATTTCAGACCATGTCTGACCAGATCATTGGGAGAATTGATGATATGAGTAGTCGCATTGATGA TCTGGAAAAGAATATCGCGGACCTCATGACACAGGCTGGGGTGGAAGAACTGGAAAGTGAAAACAAGATA CCTGCCACGCAAAAGAGT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC201399 protein sequence
Red=Cloning site Green=Tags(s) MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKI PATQKS myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001537 |
ORF Size | 228 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001537.4 |
RefSeq Size | 1989 bp |
RefSeq ORF | 231 bp |
Locus ID | 3281 |
UniProt ID | O75506 |
Protein Families | Transcription Factors |
MW | 8.5 kDa |
Gene Summary | The heat-shock response is elicited by exposure of cells to thermal and chemical stress and through the activation of HSFs (heat shock factors) results in the elevated expression of heat-shock induced genes. Heat shock factor binding protein 1 (HSBP1), is a 76-amino-acid protein that binds to heat shock factor 1(HSF1), which is a transcription factor involved in the HS response. During HS response, HSF1 undergoes conformational transition from an inert non-DNA-binding monomer to active functional trimers. HSBP1 is nuclear-localized and interacts with the active trimeric state of HSF1 to negatively regulate HSF1 DNA-binding activity. Overexpression of HSBP1 in mammalian cells represses the transactivation activity of HSF1. When overexpressed in C.elegans HSBP1 has severe effects on survival of the animals after thermal and chemical stress consistent with a role of HSBP1 as a negative regulator of heat shock response. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC201399L1 | Lenti ORF clone of Human heat shock factor binding protein 1 (HSBP1), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC201399L2 | Lenti ORF clone of Human heat shock factor binding protein 1 (HSBP1), mGFP tagged |
CNY 5,890.00 |
|
RC201399L3 | Lenti ORF clone of Human heat shock factor binding protein 1 (HSBP1), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC201399L4 | Lenti ORF clone of Human heat shock factor binding protein 1 (HSBP1), mGFP tagged |
CNY 5,890.00 |
|
RG201399 | HSBP1 (tGFP-tagged) - Human heat shock factor binding protein 1 (HSBP1) |
CNY 2,800.00 |
|
SC119194 | HSBP1 (untagged)-Human heat shock factor binding protein 1 (HSBP1) |
CNY 1,200.00 |