LAMTOR1 (NM_017907) Human Tagged ORF Clone
CAT#: RC200159
LAMTOR1 (Myc-DDK-tagged)-Human late endosomal/lysosomal adaptor, MAPK and MTOR activator 1 (LAMTOR1)
ORF Plasmid: tGFP
"NM_017907" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | C11orf59; p18; p27RF-Rho; PDRO; Ragulator1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC200159 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGGTGCTGCTACAGCAGCGAGAACGAGGACTCGGACCAGGACCGAGAGGAGCGGAAGCTGCTGCTGG ACCCTAGCAGCCCCCCTACCAAAGCTCTCAATGGAGCCGAGCCCAACTACCACAGCCTGCCTTCCGCTCG CACTGATGAGCAGGCCCTGCTCTCTTCCATCCTTGCCAAGACAGCCAGCAACATCATTGATGTGTCTGCT GCAGACTCACAGGGCATGGAGCAGCATGAGTACATGGACCGTGCCAGGCAGTACAGCACCCGCTTGGCTG TGCTGAGCAGCAGCCTGACCCATTGGAAGAAGCTGCCACCGCTGCCGTCTCTTACCAGCCAGCCCCACCA AGTGCTGGCCAGTGAGCCCATCCCGTTCTCTGATTTGCAGCAGGTCTCCAGGATAGCTGCTTATGCCTAC AGTGCACTTTCTCAGATCCGTGTGGACGCAAAAGAGGAGCTGGTTGTACAGTTTGGGATCCCA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC200159 protein sequence
Red=Cloning site Green=Tags(s) MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSA ADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLASEPIPFSDLQQVSRIAAYAY SALSQIRVDAKEELVVQFGIP myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_017907 |
ORF Size | 483 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_017907.3 |
RefSeq Size | 1198 bp |
RefSeq ORF | 486 bp |
Locus ID | 55004 |
UniProt ID | Q6IAA8 |
MW | 17.7 kDa |
Gene Summary | As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. LAMTOR1 is directly responsible for anchoring the Ragulator complex to membranes. Also required for late endosomes/lysosomes biogenesis it may regulate both the recycling of receptors through endosomes and the MAPK signaling pathway through recruitment of some of its components to late endosomes. May be involved in cholesterol homeostasis regulating LDL uptake and cholesterol release from late endosomes/lysosomes. May also play a role in RHOA activation.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC200159L1 | Lenti ORF clone of Human late endosomal/lysosomal adaptor, MAPK and MTOR activator 1 (LAMTOR1), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC200159L2 | Lenti ORF clone of Human late endosomal/lysosomal adaptor, MAPK and MTOR activator 1 (LAMTOR1), mGFP tagged |
CNY 5,890.00 |
|
RC200159L3 | Lenti ORF clone of Human late endosomal/lysosomal adaptor, MAPK and MTOR activator 1 (LAMTOR1), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC200159L4 | Lenti ORF clone of Human late endosomal/lysosomal adaptor, MAPK and MTOR activator 1 (LAMTOR1), mGFP tagged |
CNY 3,600.00 |
|
RG200159 | LAMTOR1 (tGFP-tagged) - Human late endosomal/lysosomal adaptor, MAPK and MTOR activator 1 (LAMTOR1) |
CNY 4,370.00 |
|
SC126849 | LAMTOR1 (untagged)-Human late endosomal/lysosomal adaptor, MAPK and MTOR activator 1 (LAMTOR1) |
CNY 3,990.00 |
其它LAMTOR1产品