ATF5 (NM_012068) Human Tagged ORF Clone
CAT#: RC200081
- TrueORF®
ATF5 (Myc-DDK-tagged)-Human activating transcription factor 5 (ATF5), transcript variant 1
ORF Plasmid: tGFP
"NM_012068" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 4,465.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | ATFX; HMFN0395 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC200081 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCACTCCTGGCGACCCTGGGGCTGGAGCTGGACAGGGCCCTGCTCCCAGCTAGTGGGCTGGGATGGC TCGTAGACTATGGGAAACTCCCCCCGGCCCCTGCCCCCCTGGCTCCCTATGAGGTCCTTGGGGGAGCCCT GGAGGGCGGGCTTCCAGTGGGGGGAGAGCCCCTGGCAGGTGATGGCTTCTCTGACTGGATGACTGAGCGA GTTGATTTCACAGCTCTCCTCCCTCTGGAGCCTCCCCTACCCCCCGGCACCCTCCCCCAACCTTCCCCAA CCCCACCTGACCTGGAAGCTATGGCCTCCCTCCTCAAGAAGGAGCTGGAACAGATGGAAGACTTCTTCCT AGATGCCCCGCTCCTCCCACCACCCTCCCCGCCGCCACTACCACCACCACCACTACCACCAGCCCCCTCC CTCCCCCTGTCCCTCCCCTCCTTTGACCTCCCCCAGCCCCCTGTCTTGGATACTCTGGACTTGCTGGCCA TCTACTGCCGCAACGAGGCCGGGCAGGAGGAAGTGGGGATGCCGCCTCTGCCCCCGCCACAGCAGCCCCC TCCTCCTTCTCCACCTCAACCTTCTCGCCTGGCCCCCTACCCACATCCTGCCACCACCCGAGGGGACCGC AAGCAAAAGAAGAGAGACCAGAACAAGTCGGCGGCTCTGAGGTACCGCCAGCGGAAGCGGGCAGAGGGTG AGGCCCTGGAGGGCGAGTGCCAGGGGCTGGAGGCACGGAATCGCGAGCTGAAGGAACGGGCAGAGTCCGT GGAGCGCGAGATCCAGTACGTCAAGGACCTGCTCATCGAGGTTTACAAGGCCCGGAGCCAGAGGACCCGT AGCTGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC200081 protein sequence
Red=Cloning site Green=Tags(s) MSLLATLGLELDRALLPASGLGWLVDYGKLPPAPAPLAPYEVLGGALEGGLPVGGEPLAGDGFSDWMTER VDFTALLPLEPPLPPGTLPQPSPTPPDLEAMASLLKKELEQMEDFFLDAPLLPPPSPPPLPPPPLPPAPS LPLSLPSFDLPQPPVLDTLDLLAIYCRNEAGQEEVGMPPLPPPQQPPPPSPPQPSRLAPYPHPATTRGDR KQKKRDQNKSAALRYRQRKRAEGEALEGECQGLEARNRELKERAESVEREIQYVKDLLIEVYKARSQRTR SC myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_012068 |
ORF Size | 846 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_012068.5 |
RefSeq Size | 2293 bp |
RefSeq ORF | 849 bp |
Locus ID | 22809 |
UniProt ID | Q9Y2D1 |
Domains | BRLZ |
Protein Families | Transcription Factors |
MW | 30.7 kDa |
Gene Summary | Transcription factor that either stimulates or represses gene transcription through binding of different DNA regulatory elements such as cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), ATF5-specific response element (ARE) (consensus: 5'-C[CT]TCT[CT]CCTT[AT]-3') but also the amino acid response element (AARE), present in many viral and cellular promoters. Critically involved, often in a cell type-dependent manner, in cell survival, proliferation, and differentiation (PubMed:10373550, PubMed:15358120, PubMed:21212266, PubMed:20654631). Its transcriptional activity is enhanced by CCND3 and slightly inhibited by CDK4 (PubMed:15358120). Important regulator of the cerebral cortex formation, functions in cerebral cortical neuroprogenitor cells to maintain proliferation and to block differentiation into neurons. Must be down-regulated in order for such cells to exit the cycle and differentiate (By similarity). Participates in the pathways by which SHH promotes cerebellar granule neuron progenitor cells proliferation (By similarity). Critical for survival of mature olfactory sensory neurons (OSN), directs expression of OSN-specific genes (By similarity). May be involved in osteogenic differentiation (PubMed:22442021). Promotes cell proliferation and survival by inducing the expression of EGR1 sinergistically with ELK1. Once acetylated by EP300, binds to ARE sequences on target genes promoters, such as BCL2 and EGR1 (PubMed:21791614). Plays an anti-apoptotic role through the transcriptional regulation of BCL2, this function seems to be cell type-dependent (By similarity). Cooperates with NR1I3/CAR in the transcriptional activation of CYP2B6 in liver (PubMed:18332083). In hepatic cells, represses CRE-dependent transcription and inhibits proliferation by blocking at G2/M phase (PubMed:22528486, PubMed:18701499). May act as a negative regulator of IL1B transduction pathway in liver (PubMed:24379400). Upon IL1B stimulus, cooperates with NLK to activate the transactivation activity of C/EBP subfamily members (PubMed:25512613). Besides its function of transcription factor, acts as a cofactor of CEBPB to activate CEBPA and promote adipocyte differentiation (PubMed:24216764). Regulates centrosome dynamics in a cell-cycle- and centriole-age-dependent manner. Forms 9-foci symmetrical ring scaffold around the mother centriole to control centrosome function and the interaction between centrioles and pericentriolar material (PubMed:26213385).[UniProtKB/Swiss-Prot Function] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
UPRmt activation protects against MPP+-induced toxicity in a cell culture model of Parkinson\'s disease
,Hu, D;Liu, Z;Qi, X;,
Biochemical and Biophysical Research Communications
,PubMed ID 34216993
[ATF5]
|
Gene Regulatory Network Analysis and Engineering Directs Development and Vascularization of Multilineage Human Liver Organoids
,Velazquez, JJ;LeGraw, R;Moghadam, F;Tan, Y;Kilbourne, J;Maggiore, JC;Hislop, J;Liu, S;Cats, D;Chuva de Sousa Lopes, SM;Plaisier, C;Cahan, P;Kiani, S;Ebrahimkhani, MR;,
Cell systems
,PubMed ID 33290741
[ATF5]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC200081L1 | Lenti ORF clone of Human activating transcription factor 5 (ATF5), transcript variant 1, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC200081L2 | Lenti ORF clone of Human activating transcription factor 5 (ATF5), transcript variant 1, mGFP tagged |
CNY 4,800.00 |
|
RC200081L3 | Lenti ORF clone of Human activating transcription factor 5 (ATF5), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC200081L4 | Lenti ORF clone of Human activating transcription factor 5 (ATF5), transcript variant 1, mGFP tagged |
CNY 4,800.00 |
|
RG200081 | ATF5 (tGFP-tagged) - Human activating transcription factor 5 (ATF5), transcript variant 1 |
CNY 4,370.00 |
|
SC319384 | ATF5 (untagged)-Human activating transcription factor 5 (ATF5), transcript variant 1 |
CNY 2,400.00 |