Maf1 (NM_001164608) Mouse Tagged ORF Clone

CAT#: MR225889

  • TrueORF®

Maf1 (Myc-DDK-tagged) - Mouse MAF1 homolog (S. cerevisiae) (Maf1), transcript variant 3

ORF Plasmid: DDK tGFP



  "NM_001164608" in other vectors (3)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,810.00


货期*
2周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Maf1 Antibody - N-terminal region
    • 100 ul

CNY 5,250.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 1110068E11Rik; AU042856
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR225889 representing NM_001164608
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCTATTGGAGAACTCCAGCTTTGAGGCCATCAACTCACAGTTGACAGTGGAGACTGGAGATGCCC
ATATTATTGGCAGGATTGAAAGCTACTCGTGTAAGATGGCGGGAGATGATAAACATATGTTCAAGCAGTT
CTGCCAGGAGGGCCAGCCCCATGTGTTGGAGGCACTGTCCCCACCCCAAACTTCAGGCCTCAGTCCCAGC
AGACTGAGCAAGAGCCAGGGTGGTGAGGATGAGAGTCCTCTGAGCGACAAGTGCAGCCGCAAGACCCTCT
TCTATCTGATTGCCACCCTCAATGAGTCCTTCCGGCCAGACTATGACTTCAGCACAGCCAGAAGTCATGA
ATTCAGCCGAGAGCCAAGCCTCCGCTGGGTGGTAAATGCAGTCAACTGCAGCCTGTTTTCAGCTGTTCGT
GAAGACTTCAAGGCCCTGAAGCCACAGCTGTGGAATGCAGTGGATGAGGAGATCTGCTTAGCTGAGTGTG
ACATCTACAGCTATAACCCAGATCTAGACTCCGACCCCTTTGGGGAAGATGGAAGCCTCTGGTCATTCAA
CTATTTCTTTTACAATAAGAGACTGAAGCGAATTGTCTTCTTTAGCTGCCGCTCCATCAGTGGCTCCACG
TACACACCCTCAGAGGCAGGCAATGCACTGGACTTGGAACTGGGGGCAGAGGAGGCTGATGAAGAGAGTG
GAGGTGGAGGCGGTGAGGGCAGGGCAGAGGAGACCAGCACCATGGAGGAAGACAGGGTTCCAGTGATCTG
TATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR225889 representing NM_001164608
Red=Cloning site Green=Tags(s)

MKLLENSSFEAINSQLTVETGDAHIIGRIESYSCKMAGDDKHMFKQFCQEGQPHVLEALSPPQTSGLSPS
RLSKSQGGEDESPLSDKCSRKTLFYLIATLNESFRPDYDFSTARSHEFSREPSLRWVVNAVNCSLFSAVR
EDFKALKPQLWNAVDEEICLAECDIYSYNPDLDSDPFGEDGSLWSFNYFFYNKRLKRIVFFSCRSISGST
YTPSEAGNALDLELGAEEADEESGGGGGEGRAEETSTMEEDRVPVICM

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001164608
ORF Size 774 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001164608.1, NP_001158080.1
RefSeq Size 1656 bp
RefSeq ORF 777 bp
Locus ID 68877
UniProt ID Q9D0U6
MW 29.2 kDa
Gene Summary Plays a role in the repression of RNA polymerase III-mediated transcription in response to changing nutritional, environmental and cellular stress conditions to balance the production of highly abundant tRNAs, 5S rRNA, and other small non-coding RNAs with cell growth and maintenance (By similarity). Plays also a key role in cell fate determination by promoting mesorderm induction and adipocyte differentiation (PubMed:30110641). Mechanistically, associates with the RNA polymerase III clamp and thereby impairs its recruitment to the complex made of the promoter DNA, TBP and the initiation factor TFIIIB. When nutrients are available and mTOR kinase is active, MAF1 is hyperphosphorylated and RNA polymerase III is engaged in transcription. Stress-induced MAF1 dephosphorylation results in nuclear localization, increased targeting of gene-bound RNA polymerase III and a decrease in the transcriptional readout. Additionally, may also regulate RNA polymerase I and RNA polymerase II-dependent transcription through its ability to regulate expression of the central initiation factor TBP (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...