Brcc3 (NM_001166457) Mouse Tagged ORF Clone

CAT#: MR223950

  • TrueORF®

Brcc3 (Myc-DDK-tagged) - Mouse BRCA1/BRCA2-containing complex, subunit 3 (Brcc3), transcript variant 1

ORF Plasmid: DDK tGFP



  "NM_001166457" in other vectors (3)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00

CNY 3,810.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms C6.1A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR223950 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGTGCAGGTGGTGCAAGCTGTGCAGGCGGTTCATCTTGAGTCTGACGCTTTCCTAGTTTGTCTCA
ACCATGCTCTGAGCACAGAAAAGGAGGAAGTGATGGGTCTGTGTATAGGGGAGTTGAATGATGACATAAG
GAGTGACTCCAAATTTACATACACTGGAACGGAAATGCGCACAGTCCAAGAAAAGATGGATACCATCAGA
ATTGTTCATATCCATTCTGTCATCATCTTGCGGCGTTCTGACAAGAGAAAGGACCGTGTAGAAATTTCTC
CAGAGCAGCTGTCTGCAGCTTCAACAGAGGCAGAAAGGTTGGCTGAACTAACAGGTCGTCCCATGAGAGT
TGTTGGCTGGTATCATTCCCACCCTCATATAACTGTTTGGCCTTCACATGTTGATGTTCGTACACAAGCC
ATGTACCAAATGATGGATCAAGGCTTTGTAGGACTTATTTTTTCCTGTTTCATAGAAGACAAAAACACAA
AGACTGGCCGGGTACTCTATACTTGCTTCCAATCCATACAAGCCCAAAAAAGCTCAGAGTATGAGAGAAT
TGAAATCCCAATCCATATTGTACCTCATATCACTATTGGGAAAGTATGCCTTGAATCTGCAGTAGAGCTG
CCAAAAATCCTGTGTCAGGAAGAACAGGATGCATATAGAAGGATTCACAGCCTTACACATCTGGACTCAG
TGACCAAGATCCATAATGGCTCAGTATTTACCAAGAATTTGTGCAGTCAGATGTCAGCAGTCAGTGGGCC
TCTACTGCAGTGGTTGGAAGACAGATTGGAGCAAAACCAGCAGCATTTGCAGGAGTTGCAACAAGAAAAG
GAAGAGCTTATGGAAGAGCTGTCTTCCCTAGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR223950 protein sequence
Red=Cloning site Green=Tags(s)

MAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDIRSDSKFTYTGTEMRTVQEKMDTIR
IVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQA
MYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSEYERIEIPIHIVPHITIGKVCLESAVEL
PKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEK
EELMEELSSLE

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001166457
ORF Size 876 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001166457.1, NP_001159929.1
RefSeq Size 4338 bp
RefSeq ORF 876 bp
Locus ID 210766
UniProt ID P46737
MW 33.3 kDa
Gene Summary Metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not have activity toward 'Lys-48'-linked polyubiquitin chains. Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). In the BRCA1-A complex, it specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX, antagonizing the RNF8-dependent ubiquitination at double-strand breaks (DSBs). Catalytic subunit of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin in various substrates. Mediates the specific 'Lys-63'-specific deubiquitination associated with the COP9 signalosome complex (CSN), via the interaction of the BRISC complex with the CSN complex. The BRISC complex is required for normal mitotic spindle assembly and microtubule attachment to kinetochores via its role in deubiquitinating NUMA1. Plays a role in interferon signaling via its role in the deubiquitination of the interferon receptor IFNAR1; deubiquitination increases IFNAR1 activity by enhancing its stability and cell surface expression. Down-regulates the response to bacterial lipopolysaccharide (LPS) via its role in IFNAR1 deubiquitination.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...