Zfand2b (NM_026846) Mouse Tagged ORF Clone

CAT#: MR219158

  • TrueORF®

Zfand2b (Myc-DDK-tagged) - Mouse zinc finger, AN1 type domain 2B (Zfand2b), transcript variant 1

ORF Plasmid: DDK tGFP



  "NM_026846" in other vectors (5)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00

CNY 3,810.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 1110060O18Rik; C81256
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR219158 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGTTTCCGGACCTCGGGGCTCACTGTTCCGAGCCGAGCTGTCAGCGCTTGGATTTTTTGCCACTCA
AGTGCGATGCCTGCTCGGGCATCTTCTGCGCAGACCATGTGGCCTACGCCCAGCATCACTGTGGATCAGC
TTACCAAAAGGATATCCAGGTACCTGTGTGCCCTCTCTGTAATGTGCCTGTGCCGGTGGCCAGAGGAGAG
CCTCCTGACCGTGCTGTGGGAGAGCACATTGACAGAGACTGTCGTTCTGACCCAGCACAGCAAAAACGCA
AGATCTTCACCAATAAGTGTGAACGTTCTGGCTGCCGGCAGCGGGAGATGATGAAACTGACTTGTGATCG
CTGTGGCCGAAACTTCTGCATCAAGCACCGTCATCCCCTGGACCATGAATGCTCTGGGGAAGGTCATCAG
ACCAGCAGGGCAGGGCTTGCTGCTATTTCTAGAGCACAAGGTCTGGCTTCTACAAGCACCGCCCCCAGTC
CAAGCCGGACCTTGCCTTCATCATCCTCCCCAAGCAGAGCTACACCCCAGCTTCCAACCAGGACAGCCTC
TCCTGTTATTGCTTTGCAGAATGGCTTGAGTGAGGATGAGGCCCTGCAGCGTGCCCTGGAACTGTCCCTT
GCGGAGGCTAAACCCCAGGTTCTAAGTTCTCAGGAGGAAGACGACTTGGCGTTAGCACAGGCACTGTCAG
CCAGTGAGGCAGAATACCAACAGCAGCAGGCGCAGAGTCGTAGCTTGAAGCCGTCCAACTGCAGCCTGTG
C


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR219158 protein sequence
Red=Cloning site Green=Tags(s)

MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLCNVPVPVARGE
PPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERSGCRQREMMKLTCDRCGRNFCIKHRHPLDHECSGEGHQ
TSRAGLAAISRAQGLASTSTAPSPSRTLPSSSSPSRATPQLPTRTASPVIALQNGLSEDEALQRALELSL
AEAKPQVLSSQEEDDLALAQALSASEAEYQQQQAQSRSLKPSNCSLC

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_026846
ORF Size 774 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_026846.3, NP_081122.2
RefSeq Size 1240 bp
RefSeq ORF 774 bp
Locus ID 68818
UniProt ID Q91X58
MW 27.9 kDa
Gene Summary Plays a role in protein homeostasis by regulating both the translocation and the ubiquitin-mediated proteasomal degradation of nascent proteins at the endoplasmic reticulum (PubMed:24160817, PubMed:26337389, PubMed:26692333). It is involved in the regulation of signal-mediated translocation of proteins into the endoplasmic reticulum (PubMed:24160817). It also plays a role in the ubiquitin-mediated proteasomal degradation of proteins for which signal-mediated translocation to the endoplasmic reticulum has failed (PubMed:18467495, PubMed:26337389). May therefore function in the endoplasmic reticulum stress-induced pre-emptive quality control, a mechanism that selectively attenuates the translocation of newly synthesized proteins into the endoplasmic reticulum and reroutes them to the cytosol for proteasomal degradation (PubMed:24160817, PubMed:26337389). By controlling the steady-state expression of the IGF1R receptor, indirectly regulates the insulin-like growth factor receptor signaling pathway (PubMed:26692333).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...