Mxi1 (NM_010847) Mouse Tagged ORF Clone

CAT#: MR218931

  • TrueORF®

Mxi1 (Myc-DDK-tagged) - Mouse Max interacting protein 1 (Mxi1), transcript variant 1

ORF Plasmid: DDK tGFP



  "NM_010847" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,280.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms bHLHc11; Gm10197; Mad2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR218931 representing NM_010847
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCGGGTGCGGATGATCAACGTGCAGCGCCTGCTGGAGGCCGCGGAGTTTTTGGAGCGCAGGGAGC
GAGAGTGTGAACATGGCTACGCCTCATCGTTCCCCTCCATGCCGAGCCCCCGGCTACAGCACTCGAAGCC
CCCACGGAGGTTGAGCCGGGCACAGAAACACAGCAGTGGAAGCAGCAACACCAGCACTGCCAACAGATCT
ACACACAATGAGTTGGAAAAGAACCGACGAGCTCACCTGCGCCTGTGTTTAGAACGCTTGAAAGTTCTGA
TCCCGCTGGGCCCAGACTGCACCAGGCACACAACACTCGGTTTGCTCAACAAAGCCAAAGCACACATCAA
GAAACTTGAAGAAGCGGAGAGGAAGAGCCAGCACCAGCTAGAGAACTTGGAACGAGAACAGAGGTTTTTA
AAGCGGCGACTGGAACAGCTGCAGGGGCCTCAGGAGATGGAGCGGATACGAATGGACAGCATTGGATCAA
CCATCTCTTCAGATCGCTCGGATTCAGAGCGAGAGGAGATTGAAGTGGATGTGGAAAGCACAGAGTTCTC
CCATGGAGAAGCAGACAGTGTCAGTACCACCAGCATCAGTGACCTTGACGACCACAGCAGCCTGCAGAGT
GTCGGGAGTGACGAGGGTTATTCCAGTGCCAGTGTCAAACTCTCCTTCGCGTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR218931 representing NM_010847
Red=Cloning site Green=Tags(s)

MERVRMINVQRLLEAAEFLERRERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRS
THNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLEEAERKSQHQLENLEREQRFL
KRRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFSHGEADSVSTTSISDLDDHSSLQS
VGSDEGYSSASVKLSFAS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_010847
ORF Size 684 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_010847.4
RefSeq Size 4996 bp
RefSeq ORF 687 bp
Locus ID 17859
UniProt ID P50540
MW 26.4 kDa
Gene Summary This gene encodes a protein containing a helix-loop-helix domain characteristic of transcription factors, which allows heterodimerization and sequence-specific DNA binding. The encoded protein is related to a family of Myc/Max/Mad proteins that are involved in the regulation of several cellular processes. The protein encoded by this gene is a transcriptional repressor thought to negatively regulate Myc function. Three alternatively spliced transcripts encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...