Rnps1 (NM_001080128) Mouse Tagged ORF Clone

CAT#: MR217211

  • TrueORF®

Rnps1 (Myc-DDK-tagged) - Mouse ribonucleic acid binding protein S1 (Rnps1), transcript variant 3

ORF Plasmid: DDK tGFP



  "NM_001080128" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,850.00


货期*
2周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


RNPS1 Antibody - middle region
    • 100 ul

CNY 5,250.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR217211 representing NM_001080128
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCCTTCTCCTACCAAACGCAAGGACCGATCTGATGAGAAGTCCAAGGATCGATCTAAAGATAAAG
GGGCCACTAAAGAGTCAAGTGAGAAGGATCGTGGCAGAGATAAGACTCGGAAGAGACGCAGTGCTTCAAG
CGGAAGCAGCAGTACCAGGTCTAGGTCCAGCTCCACCTCCAGCTCGGGCTCCAGCACCAGCACAGGCTCA
AGCAGTGGCTCCAGCTCGTCCTCTGCATCCAGCCGCTCAGGAAGCTCCAGCACGTCCCGGAGCTCCAGTT
CTAGCAGCTCCTCCGGCTCCCCAAGCCCTTCTCGGCGCAGGCATGACAACAGGCGGCGCTCCCGCTCCAA
ATCCAAACCACCTAAAAGAGATGAAAAAGAGAGGAAAAGGCGGAGCCCTTCACCTAAACCAACCAAAGTG
CACATTGGGAGGCTCACCAGGAATGTGACCAAGGATCATATCATGGAAATATTTTCTACTTACGGGAAAA
TTAAAATGATTGACATGCCTGTTGAGAGGATGCATCCTCACCTCTCCAAAGGCTATGCATATGTGGAGTT
TGAGAATCCCGATGAAGCAGAGAAGGCTCTGAAACACATGGATGGAGGACAAATTGATGGCCAAGAGATC
ACTGCTACTGCTGTGTTGGCACCCTGGCCTCGGCCACCACCTCGGCGATTCAGCCCCCCTAGGAGGATGC
TTCCACCACCTCCCATGTGGCGTAGGTCACCCCCACGGATGAGGAGAAGGTCTCGATCCCCAAGACGCAG
GTCCCCTGTGCGTAGGAGGTCTCGCTCTCCTGGCCGCCGCCGCCACAGGAGCCGATCCAGCTCCAACTCC
TCCCGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR217211 representing NM_001080128
Red=Cloning site Green=Tags(s)

MAPSPTKRKDRSDEKSKDRSKDKGATKESSEKDRGRDKTRKRRSASSGSSSTRSRSSSTSSSGSSTSTGS
SSGSSSSSASSRSGSSSTSRSSSSSSSSGSPSPSRRRHDNRRRSRSKSKPPKRDEKERKRRSPSPKPTKV
HIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEI
TATAVLAPWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVRRRSRSPGRRRHRSRSSSNS
SR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001080128
ORF Size 846 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001080128.1, NP_001073597.1
RefSeq Size 1631 bp
RefSeq ORF 849 bp
Locus ID 19826
UniProt ID Q99M28
MW 32.2 kDa
Gene Summary Part of pre- and post-splicing multiprotein mRNP complexes. Auxiliary component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Component of the ASAP and PSAP complexes which bind RNA in a sequence-independent manner and are proposed to be recruited to the EJC prior to or during the splicing process and to regulate specific excision of introns in specific transcription subsets. The ASAP complex can inhibit RNA processing during in vitro splicing reactions. The ASAP complex promotes apoptosis and is disassembled after induction of apoptosis. Enhances the formation of the ATP-dependent A complex of the spliceosome. Involved in both constitutive splicing and, in association with SRP54 and TRA2B/SFRS10, in distinctive modulation of alternative splicing in a substrate-dependent manner. Involved in the splicing modulation of BCL2L1/Bcl-X (and probably other apoptotic genes); specifically inhibits formation of proapoptotic isoforms such as Bcl-X(S); the activity is different from the established EJC assembly and function. Participates in mRNA 3'-end cleavage. Involved in UPF2-dependent nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Also mediates increase of mRNA abundance and translational efficiency. Binds spliced mRNA 20-25 nt upstream of exon-exon junctions (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...