Cdk9 (NM_130860) Mouse Tagged ORF Clone

CAT#: MR205733

  • TrueORF®

Cdk9 (Myc-DDK-tagged) - Mouse cyclin-dependent kinase 9 (CDC2-related kinase) (Cdk9)

ORF Plasmid: DDK tGFP



  "NM_130860" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,656.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms PITALRE
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR205733 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAAGCAGTACGACTCGGTGGAATGCCCGTTCTGCGATGAGGTCACCAAGTACGAGAAACTTGCCA
AGATCGGCCAAGGCACATTCGGGGAAGTCTTTAAAGCCAAGCACCGTCAGACGGGCCAGAAGGTGGCTCT
GAAGAAAGTGTTGATGGAGAATGAGAAGGAGGGGTTCCCCATCACAGCCTTGAGGGAAATCAAGATTCTA
CAGCTCCTAAAACATGAGAATGTGGTGAACCTAATTGAGATTTGTCGGACCAAAGCCTCACCGTATAACC
GCTGCAAGGGCAGCATCTATCTGGTGTTTGACTTCTGTGAGCATGACCTTGCTGGGCTGCTGAGCAACGT
CTTAGTCAAGTTCACGTTGTCTGAGATCAAGAGAGTGATGCAGATGCTGCTGAACGGCCTCTACTACATC
CACAGGAACAAGATCCTGCACAGGGACATGAAGGCTGCGAATGTGCTCATTACCCGGGATGGGGTCCTGA
AGCTGGCAGATTTTGGGCTGGCCCGTGCCTTCAGCCTAGCTAAGAATAGCCAGCCCAACCGATACACCAA
CCGTGTGGTGACATTGTGGTACCGGCCTCCGGAGCTGCTGCTCGGAGAGCGGGACTACGGCCCGCCCATT
GACCTTTGGGGTGCTGGGTGCATCATGGCAGAGATGTGGACTCGTAGCCCTATCATGCAGGGTAACACAG
AGCAGCACCAGCTCGCCCTCATCAGCCAGCTCTGTGGCTCCATCACCCCAGAGGTGTGGCCAAACGTAGA
CAAGTATGAGCTGTTTGAAAAGCTGGAACTTGTGAAGGGCCAGAAGCGGAAGGTGAAGGACCGTCTGAAG
GCCTACGTGCGCGACCCCTATGCTCTGGACCTCATTGACAAGCTGCTGGTGCTGGACCCCGCGCAGCGGA
TTGACAGTGACGATGCCCTCAACCACGACTTCTTCTGGTCGGACCCCATGCCCTCGGACCTCAAGGGCAT
GCTGTCTACTCACTTGACGTCTATGTTTGAGTACCTGGCACCGCCACGGCGGAAGGGCAGCCAGATCACC
CAGCAGTCCACCAACCAGAGCAGAAATCCCGCCACCACCAACCAGACGGAATTTGAACGTGTCTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR205733 protein sequence
Red=Cloning site Green=Tags(s)

MAKQYDSVECPFCDEVTKYEKLAKIGQGTFGEVFKAKHRQTGQKVALKKVLMENEKEGFPITALREIKIL
QLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYI
HRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPI
DLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDKYELFEKLELVKGQKRKVKDRLK
AYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQIT
QQSTNQSRNPATTNQTEFERVF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_130860
ORF Size 1119 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_130860.3
RefSeq Size 3389 bp
RefSeq ORF 1119 bp
Locus ID 107951
UniProt ID Q99J95
MW 42.8 kDa
Gene Summary Protein kinase involved in the regulation of transcription. Member of the cyclin-dependent kinase pair (CDK9/cyclin-T) complex, also called positive transcription elongation factor b (P-TEFb), which facilitates the transition from abortive to productive elongation by phosphorylating the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAP II) POLR2A, SUPT5H and RDBP. This complex is inactive when in the 7SK snRNP complex form. Phosphorylates EP300, MYOD1, RPB1/POLR2A and AR, and the negative elongation factors DSIF and NELF. Regulates cytokine inducible transcription networks by facilitating promoter recognition of target transcription factors (e.g. TNF-inducible RELA/p65 activation and IL-6-inducible STAT3 signaling). Promotes RNA synthesis in genetic programs for cell growth, differentiation and viral pathogenesis. P-TEFb is also involved in cotranscriptional histone modification, mRNA processing and mRNA export. Modulates a complex network of chromatin modifications including histone H2B monoubiquitination (H2Bub1), H3 lysine 4 trimethylation (H3K4me3) and H3K36me3; integrates phosphorylation during transcription with chromatin modifications to control co-transcriptional histone mRNA processing. The CDK9/cyclin-K complex has also a kinase activity towards CTD of RNAP II and can substitute for CDK9/cyclin-T P-TEFb in vitro. Replication stress response protein; the CDK9/cyclin-K complex is required for genome integrity maintenance, by promoting cell cycle recovery from replication arrest and limiting single-stranded DNA amount in response to replication stress, thus reducing the breakdown of stalled replication forks and avoiding DNA damage. In addition, probable function in DNA repair of isoform 2 via interaction with KU70/XRCC6. Promotes cardiac myocyte enlargement. RPB1/POLR2A phosphorylation on 'Ser-2' in CTD activates transcription. AR phosphorylation modulates AR transcription factor promoter selectivity and cell growth. DSIF and NELF phosphorylation promotes transcription by inhibiting their negative effect. The phosphorylation of MYOD1 enhances its transcriptional activity and thus promotes muscle differentiation (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...