Nov (NM_010930) Mouse Tagged ORF Clone

CAT#: MR205398

  • TrueORF®

Nov (Myc-DDK-tagged) - Mouse nephroblastoma overexpressed gene (Nov)

ORF Plasmid: DDK tGFP



  "NM_010930" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,656.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms C130088N23Rik; CCN3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR205398 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCCTCTTCCTGCGAAAGCGATGCCTCTGCCTAGGCTTCCTGCTCTTCCATCTCTTAAGTCAAGTCT
CTGCATCTCTGCGCTGCCCTTCTCGGTGCCCACCCAAGTGCCCCAGTATATCACCGACCTGCGCCCCCGG
GGTGCGCTCGGTGCTGGACGGCTGCTCCTGCTGTCCGGTGTGCGCCCGCCAGCGCGGGGAGAGTTGTTCT
GAGATGAGACCCTGTGACCAGAGCAGTGGTCTCTACTGTGACCGCAGCGCAGACCCCAACAACCAGACTG
GCATTTGCATGGTTCCAGAGGGAGACAACTGTGTGTTCGATGGGGTCATTTACCGCAACGGAGAGAAGTT
TGAGCCGAACTGTCAGTACTTCTGCACCTGCAGAGATGGGCAGATTGGCTGTCTGCCCCGCTGCCAGCTA
GACGTGCTACTGCCGGGTCCTGACTGCCCAGCTCCGAGAAAAGTCGCAGTGCCAGGGGAGTGCTGCGAAA
AGTGGACCTGTGGCTCAGACGAGCAGGGGACGCAGGGGACGCTGGGAGGCTTGGCCCTTCCAGCCTATAG
ACCGGAAGCCACCGTAGGAGTTGAAGTCTCTGACTCCAGCATTAACTGCATTGAGCAGACGACGGAGTGG
AGCGCATGTTCCAAGAGCTGTGGAATGGGCGTGTCCACCCGGGTCACCAACAGGAATCGCCAGTGTGAGA
TGGTAAAACAGACTCGTCTCTGCATCGTTCGGCCTTGTGAACAAGAGCCCGAGGAAGTAACAGACAAGAA
AGGTAAAAAGTGTCTCCGCACCAAGAAGTCCCTGAAAGCCATCCACCTACAGTTCGAGAATTGCACTAGC
TTGTACACCTATAAGCCCCGGTTCTGTGGGGTCTGCAGTGATGGCCGCTGCTGTACCCCCCACAACACCA
AAACCATCCAGGTGGAGTTTCAGTGTCTCCCGGGGGAAATCATCAAGAAACCAGTCATGGTCATTGGAAC
CTGTACCTGCTACTCCAACTGCCCTCAGAACAATGAGGCCTTCCTCCAAGATCTGGAGCTGAAGACAAGC
AGAGGAGAAATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR205398 protein sequence
Red=Cloning site Green=Tags(s)

MSLFLRKRCLCLGFLLFHLLSQVSASLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCS
EMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQL
DVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEW
SACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTS
LYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTS
RGEI

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_010930
ORF Size 1065 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_010930.1, NM_010930.2, NM_010930.3, NM_010930.4, NP_035060.1
RefSeq Size 2366 bp
RefSeq ORF 1065 bp
Locus ID 18133
UniProt ID Q64299
MW 38.9 kDa
Gene Summary Immediate-early protein playing a role in various cellular processes including proliferation, adhesion, migration, differentiation and survival. Acts by binding to integrins or membrane receptors such as NOTCH1. Essential regulator of hematopoietic stem and progenitor cell function. Inhibits myogenic differentiation through the activation of Notch-signaling pathway. Inhibits vascular smooth muscle cells proliferation by increasing expression of cell-cycle regulators such as CDKN2B or CDKN1A independently of TGFB1 signaling. Ligand of integrins ITGAV:ITGB3 and ITGA5:ITGB1, acts directly upon endothelial cells to stimulate pro-angiogenic activities and induces angiogenesis. In endothelial cells, supports cell adhesion, induces directed cell migration (chemotaxis) and promotes cell survival. Plays also a role in cutaneous wound healing acting as integrin receptor ligand. Supports skin fibroblast adhesion through ITGA5:ITGB1 and ITGA6:ITGB1 and induces fibroblast chemotaxis through ITGAV:ITGB5. Seems to enhance bFGF-induced DNA synthesis in fibroblasts (By similarity). Involved in bone regeneration as a negative regulator (PubMed:23653360). Enhances the articular chondrocytic phenotype, whereas it repressed the one representing endochondral ossification (By similarity). Impairs pancreatic beta-cell function, inhibits beta-cell proliferation and insulin secretion (PubMed:23705021). Plays a role as negative regulator of endothelial pro-inflammatory activation reducing monocyte adhesion, its anti-inflammatory effects occur secondary to the inhibition of NF-kappaB signaling pathway (By similarity). Contributes to the control and coordination of inflammatory processes in atherosclerosis (PubMed:24722330). Attenuates inflammatory pain through regulation of IL1B- and TNF-induced MMP9, MMP2 and CCL2 expression. Inhibits MMP9 expression through ITGB1 engagement (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...