Ndel1 (BC021434) Mouse Tagged ORF Clone

CAT#: MR204509

  • TrueORF®

Ndel1 (Myc-DDK-tagged) - Mouse nuclear distribution gene E-like homolog 1 (A

ORF Plasmid: DDK tGFP



  "BC021434" in other vectors (3)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00

CNY 6,365.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms NUDEL, MITAP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR204509 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGGTGAAGATATACCGGATTTTTCAAGTTTAAAGGAAGAAACTGCTTATTGGAAGGAACTTTCCT
TGAAGTATAAGCAAAGCTTCCAGGAAGCTCGGGATGAGCTAGTTGAGTTCCAGGAAGGAAGCAGAGAGTT
AGAAGCAGAGTTGGAGGCACAGTTAGTACAGGCTGAACAAAGAAATAGAGACCTGCAGGCTGATAACCAA
AGACTGAAGTATGAAGTGGAGGCGTTAAAGGAGAAACTAGAGCATCAGTATGCACAGAGCTACAAGCAGG
TCTCAGTGTTAGAAGATGATTTAAGTCAGACCCGGGCCATTAAGGAGCAACTGCATAAGTATGTGAGAGA
GCTGGAGCAGGCCAATGATGACCTGGAGCGAGCAAAAAGGGCAACAATAGTTTCACTGGAAGACTTTGAA
CAAAGGCTAAATCAGGCCATTGAACGAAATGCATTCTTAGAAAGTGAGCTCGATGAAAAGGAATCTTTGT
TGGTCTCAGTACAGAGGTTAAAGGATGAAGCCAGAGATTTAAGGCAAGAACTAGCAGTTCGGGAACGACA
ACAGGAAGTGACCCGCAAGTCTGCCCCCAGCTCTCCAACTCTGGACTGTGAGAAGATGGATTCTGCGGTC
CAGGCTTCACTCTCCTTGCCTGCAACGCCTGTTGGGAAAGGCACAGAAAACAGTTTTCCTTCACCAAAAG
CTATACCAAACGGCTTTGGAACCAGTCCACTAACTCCTTCTGCTAGGATATCAGCACTAAACATCGTGGG
AGATCTCTTGCGGAAAGTAGGGGCTTTAGAATCCAAGTTAGCCGCTTGCAGGAACTTTGCAAAAGACCAA
GCATCCCGCAAATCTTATGTTCCAGGGAGCGTTAACTGTGGGGTAATGAACAGCAATGGCCCAGAGTGCC
CAAGGTCAGGGCGAGCAACTTTCTTCCATAAAGGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR204509 protein sequence
Red=Cloning site Green=Tags(s)

MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQ
RLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFE
QRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRERQQEVTRKSAPSSPTLDCEKMDSAV
QASLSLPATPVGKGTENSFPSPKAIPNGFGTSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQ
ASRKSYVPGSVNCGVMNSNGPECPRSGRATFFHKG

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC021434
ORF Size 945 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC021434, AAH21434
RefSeq Size 1654 bp
RefSeq ORF 947 bp
Locus ID 83431
MW 35.5 kDa
Gene Summary Required for organization of the cellular microtubule array and microtubule anchoring at the centrosome. May regulate microtubule organization at least in part by targeting the microtubule severing protein KATNA1 to the centrosome. Also positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus ends. Required for several dynein- and microtubule-dependent processes such as the maintenance of Golgi integrity, the centripetal motion of secretory vesicles and the coupling of the nucleus and centrosome. Also required during brain development for the migration of newly formed neurons from the ventricular/subventricular zone toward the cortical plate. Plays a role, together with DISC1, in the regulation of neurite outgrowth. Required for mitosis in some cell types but appears to be dispensible for mitosis in cortical neuronal progenitors, which instead requires NDE1. Facilitates the polymerization of neurofilaments from the individual subunits NEFH and NEFL. Positively regulates lysosome peripheral distribution and ruffled border formation in osteoclasts (PubMed:27777970).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...