Pim2 (BC027376) Mouse Tagged ORF Clone

CAT#: MR204426

  • TrueORF®

Pim2 (Myc-DDK-tagged) - Mouse proviral integration site 2 (cDNA clone MGC:37188 IMAGE:4954711)

ORF Plasmid: DDK tGFP



  "BC027376" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00

CNY 6,365.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


PIM2 Antibody - middle region
    • 100 ul

CNY 5,250.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms DXCch3; Pim-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR204426 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGACCAAGCCTCTGCAGGGGCATCCTTCGCCCCCTGTGACCCCCACGCAGCCTCCAGGAGGCAAGG
ATCGGGCAGCTTTCGAGGCCGAATACCGACTTGGCCCCCTCCTGGGTAAGGGAGGCTTTGGCACCGTCTT
CGCGGGACACCGCGTCACGGATAGACGTCAGGTGGCCATCAAAGTAATCTCCCGGAACCGTGTGCTAGGC
TGGTCCACCGTGTCAGACTCAGTCACCTGCCCACTTGAGGTTGCGCTGCTGTGGAAGGTGGGTGAAGGCA
ATGGCCATCCGGGTGTGATACGCCTTCTTGACTGGTTCGAAACACCCGAAGGCTTCATGCTGGTCCTTGA
GCGGCCTATGCCTGCTCAGGATCTCTTCGACTATATCACAGAGAAGGGGCCGCTGGGTGAAAGCTGTAGC
CGCAGCTTCTTTACCCAAGTCGTGGCAGCTGTCCAGCACTGCCACGCCCGTGGAGTTGTCCATCGGGATA
TCAAGGATGAGAACATCCTGATCGACCTATGCCGGGGTTCCATTAAACTCATTGATTTTGGTTCCGGCGC
CCTGCTTCACGATGAGCCGTACACTGACTTTGATGGGACAAGAGTGTATAGCCCTCCAGAGTGGATCTCG
CGACACCAGTACCATGCCCTGCCAGCGACCGTCTGGTCACTAGGTGTCCTACTCTATGACATGGTCTGTG
GGGACATTCCCTTCGAGAGAGACCAGGAGATTCTGGAGGCTGAGCTGCACTTCCCTGCTCATGTCTCCCC
AGATTGCTGTGCCCTAATCCGCCGGTGCCTGGCCCCTAAACCCTGCTCCCGACCCTCACTGGAGGAGATT
CTGCTGGACCCCTGGATGCAATCACCAGCTGAAGAAAAGCCCATCAACTCCTCCAAAGGAAGCCCCACCC
CCTTGCCCTGGTCCCTGCTTCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR204426 protein sequence
Red=Cloning site Green=Tags(s)

MLTKPLQGHPSPPVTPTQPPGGKDRAAFEAEYRLGPLLGKGGFGTVFAGHRVTDRRQVAIKVISRNRVLG
WSTVSDSVTCPLEVALLWKVGEGNGHPGVIRLLDWFETPEGFMLVLERPMPAQDLFDYITEKGPLGESCS
RSFFTQVVAAVQHCHARGVVHRDIKDENILIDLCRGSIKLIDFGSGALLHDEPYTDFDGTRVYSPPEWIS
RHQYHALPATVWSLGVLLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPCSRPSLEEI
LLDPWMQSPAEEKPINSSKGSPTPLPWSLLP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC027376
ORF Size 933 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC027376, AAH27376
RefSeq Size 1974 bp
RefSeq ORF 935 bp
Locus ID 18715
MW 34.5 kDa
Gene Summary Proto-oncogene with serine/threonine kinase activity involved in cell survival and cell proliferation. Exerts its oncogenic activity through: the regulation of MYC transcriptional activity, the regulation of cell cycle progression, the regulation of cap-dependent protein translation and through survival signaling by phosphorylation of a pro-apoptotic protein, BAD. Phosphorylation of MYC leads to an increase of MYC protein stability and thereby an increase of transcriptional activity. The stabilization of MYC exerted by PIM2 might explain partly the strong synergism between these 2 oncogenes in tumorigenesis. Regulates cap-dependent protein translation in a mammalian target of rapamycin complex 1 (mTORC1)-independent manner and in parallel to the PI3K-Akt pathway. Mediates survival signaling through phosphorylation of BAD, which induces release of the anti-apoptotic protein Bcl-X(L)/BCL2L1. Promotes cell survival in response to a variety of proliferative signals via positive regulation of the I-kappa-B kinase/NF-kappa-B cascade; this process requires phosphorylation of MAP3K8/COT. Promotes growth factor-independent proliferation by phosphorylation of cell cycle factors such as CDKN1A and CDKN1B. Involved in the positive regulation of chondrocyte survival and autophagy in the epiphyseal growth plate.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...