Endov (NM_177394) Mouse Tagged ORF Clone

CAT#: MR203286

  • TrueORF®

Endov (Myc-DDK-tagged) - Mouse RIKEN cDNA A730011L01 gene (A730011L01Rik), transcript variant 2

ORF Plasmid: DDK tGFP



  "NM_177394" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Endov Antibody - middle region
    • 50 ug

CNY 5,250.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms A730011L01Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR203286 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTTGGCCTGAAGGCCCCCTATGTGTCAGGCTTCCTGGCCTTCCGAGAGGTCCCTTTCCTGGTGGAGT
TGGTACAGCGGCTGCAAGAGAAGGAACCAGATCTCATGCCCCAGGTCGTTCTTGTGGATGGAAACGGGGT
GCTTCACCAACGAGGCTTCGGGGTGGCCTGCCACCTTGGTGTCCTTACAGAGCTGCCATGCATCGGGGTG
GCCAAGAAGCTCCTGCAGGTGGATGGACTGGAGAACAATGCTCTGCACAAGGAGAAGATTGTGCTCCTGC
AGGCCGGAGGAGACACATTTCCTCTGATAGGCAGCTCTGGGACTGTCCTGGGAATGGCCCTGAGGAGCCA
TGACCACAGCACCAAGCCCCTCTATGTCTCTGTGGGCCACAGAATAAGCCTGGAGGTCGCTGTGCGCCTC
ACCCACCACTGCTGTAGGTTCCGGATCCCAGAACCTATACGCCAGGCTGACATCCGCTCTCGAGAGTACA
TCCGAAGGACTCTAGGGCAGCTTGGGGTGGCTCCTGCACAGAGAAAGGACAGGAGCCAGAAAGAGCAGAG
GCCAAATGCATGCCCCCAAGGAGGCCCAGGAGCACTTGCAGATCAAGGCAGGCCTCCTGAATGCGACGGC
AGAGACTCCAGCTCAGACCGGAAAGCCCCCGAGCCAGGCTTCCAGGAGCAGAAGGACCAGCAGTTGGAGG
GAACCGGGCATCAGGAAGACTCGGACCTCTGGCCTCCTTCTCCAGCCTGGGTACAGTCACCACCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR203286 protein sequence
Red=Cloning site Green=Tags(s)

MVGLKAPYVSGFLAFREVPFLVELVQRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGV
AKKLLQVDGLENNALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTKPLYVSVGHRISLEVAVRL
THHCCRFRIPEPIRQADIRSREYIRRTLGQLGVAPAQRKDRSQKEQRPNACPQGGPGALADQGRPPECDG
RDSSSDRKAPEPGFQEQKDQQLEGTGHQEDSDLWPPSPAWVQSPP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_177394
ORF Size 768 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_177394.3, NP_796368.1
RefSeq Size 5164 bp
RefSeq ORF 768 bp
Locus ID 338371
UniProt ID Q8C9A2
MW 28 kDa
Gene Summary Endoribonuclease that specifically cleaves inosine-containing RNAs: cleaves RNA at the second phosphodiester bond 3' to inosine. Has strong preference for single-stranded RNAs (ssRNAs) toward double-stranded RNAs (dsRNAs). Cleaves mRNAs and tRNAs containing inosine. Also able to cleave structure-specific dsRNA substrates containing the specific sites 5'-IIUI-3' and 5'-UIUU-3'. Inosine is present in a number of RNAs following editing; the function of inosine-specific endoribonuclease is still unclear: it could either play a regulatory role in edited RNAs, or be involved in antiviral response by removing the hyperedited long viral dsRNA genome that has undergone A-to-I editing. Binds branched DNA structures (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...