Cdc34 (NM_177613) Mouse Tagged ORF Clone

CAT#: MR202861

  • TrueORF®

Cdc34 (Myc-DDK-tagged) - Mouse cell division cycle 34 homolog (S. cerevisiae) (Cdc34)



  "NM_177613" in other vectors (2)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,081.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms AI327276; E2-CDC34; UBE2R1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR202861 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCGGCCGCTGGTGCCAAGCTCGCAGAAGGCGCTGCTGCTGGAACTGAAGGGGCTGCAGGAGGAGC
CGGTGGAGGGCTTCCGGGTGACGCTGGTGGACGAGGGTGACCTGTACAACTGGGAGGTGGCCATCTTCGG
GCCCCCCAACACCTACTATGAGGGCGGCTACTTCAAGGCTCGCCTCAAGTTCCCCATCGACTACCCGTAT
TCCCCACCAGCCTTCCGGTTCCTCACCAAGATGTGGCACCCAAACATCTATGAGACAGGGGACGTGTGCA
TCTCCATTCTCCATCCCCCAGTTGACGACCCACAGAGTGGGGAGCTGCCCTCAGAGCGGTGGAACCCCAC
ACAGAATGTCAGAACCATCCTCCTGAGTGTAATTTCGCTGCTGAATGAGCCCAACACCTTCTCGCCTGCC
AACGTGGACGCCTCGGTGATGTACAGAAAATGGAAGGAGAGCAAGGGGAAGGACCGCGAGTACACGGACA
TCATCCGGAAGCAGGTCCTGGGGACCAAGGTGGACGCGGAGCGCGATGGTGTGAAGGTGCCCACTACGCT
GGCCGAGTACTGCGTGAAGACCAAGGCGCCGGCGCCCGACGAGGGCTCGGACCTCTTCTACGACGACTAC
TATGAGGACGGCGAAGTGGAGGAGGCCGACAGCTGCTTTGGGGATGAAGAGGATGACTCTGGCACCGAAG
AGTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR202861 protein sequence
Red=Cloning site Green=Tags(s)

MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPY
SPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPA
NVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDY
YEDGEVEEADSCFGDEEDDSGTEES

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_177613
ORF Size 708 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_177613.2, NP_808281.1
RefSeq Size 1295 bp
RefSeq ORF 708 bp
Locus ID 216150
UniProt ID Q8CFI2
MW 26.6 kDa
Gene Summary Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Cooperates with the E2 UBCH5C and the SCF(FBXW11) E3 ligase complex for the polyubiquitination of NFKBIA leading to its subsequent proteasomal degradation. Performs ubiquitin chain elongation building ubiquitin chains from the UBE2D3-primed NFKBIA-linked ubiquitin. UBE2D3 acts as an initiator E2, priming the phosphorylated NFKBIA target at positions 'Lys-21' and/or 'Lys-22' with a monoubiquitin. Cooperates with the SCF(SKP2) E3 ligase complex to regulate cell proliferation through ubiquitination and degradation of MYBL2 and KIP1. Involved in ubiquitin conjugation and degradation of CREM isoform ICERIIgamma and ATF15 resulting in abrogation of ICERIIgamma- and ATF5-mediated repression of cAMP-induced transcription during both meiotic and mitotic cell cycles. Involved in the regulation of the cell cycle G2/M phase through its targeting of the WEE1 kinase for ubiquitination and degradation. Also involved in the degradation of beta-catenin.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...