Csrp3 (NM_013808) Mouse Tagged ORF Clone
CAT#: MR201891
- TrueORF®
Csrp3 (Myc-DDK-tagged) - Mouse cysteine and glycine-rich protein 3 (Csrp3), transcript variant 1
ORF Plasmid: tGFP
"NM_013808" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,995.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CRP3; MLP; MMLP |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR201891 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCAAACTGGGGTGGAGGTGCAAAATGTGGAGCCTGTGAAAAGACGGTCTACCATGCAGAAGAAATCC AGTGCAATGGGAGGAGTTTCCACAAGACCTGTTTCCACTGCATGGCCTGCAGGAAAGCTCTGGACAGCAC CACAGTGGCAGCTCATGAGTCAGAGATCTACTGTAAGGTGTGCTATGGGCGCAGGTATGGCCCCAAGGGG ATCGGGTTCGGACAAGGCGCTGGCTGCCTCAGCACAGACACTGGCGAGCATCTTGGCCTGCAGTTCCAAC AATCCCCAAAGCCAGCTCGAGCAGCCACCACAAGCAACCCTTCCAAATTCTCTGCAAAGTTTGGAGAATC AGAGAAGTGCCCACGATGTGGAAAGTCGGTATACGCTGCTGAGAAGGTCATGGGAGGTGGCAAGCCCTGG CACAAGACCTGCTTCCGCTGTGCCATCTGTGGGAAGAGCCTGGAGTCTACAAATGTCACTGACAAGGATG GGGAGCTCTACTGCAAAGTTTGCTATGCCAAAAATTTTGGCCCCACAGGCATTGGGTTTGGAGGGCTTAC ACAGCAAGTGGAAAAGAAGGAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR201891 protein sequence
Red=Cloning site Green=Tags(s) MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRRYGPKG IGFGQGAGCLSTDTGEHLGLQFQQSPKPARAATTSNPSKFSAKFGESEKCPRCGKSVYAAEKVMGGGKPW HKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTQQVEKKE myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_013808 |
ORF Size | 585 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_013808.4, NP_038836.1 |
RefSeq Size | 1057 bp |
RefSeq ORF | 585 bp |
Locus ID | 13009 |
UniProt ID | P50462 |
MW | 20.9 kDa |
Gene Summary | Positive regulator of myogenesis. Acts as cofactor for myogenic bHLH transcription factors such as MYOD1, and probably MYOG and MYF6. Enhances the DNA-binding activity of the MYOD1:TCF3 isoform E47 complex and may promote formation of a functional MYOD1:TCF3 isoform E47:MEF2A complex involved in myogenesis (By similarity). Plays a crucial and specific role in the organization of cytosolic structures in cardiomyocytes. Could play a role in mechanical stretch sensing. May be a scaffold protein that promotes the assembly of interacting proteins at Z-line structures. It is essential for calcineurin anchorage to the Z line. Required for stress-induced calcineurin-NFAT activation (PubMed:9039266, PubMed:15665106). The role in regulation of cytoskeleton dynamics by association with CFL2 is reported conflictingly. Proposed to contribute to the maintenance of muscle cell integerity through an actin-based mechanism. Can directly bind to actin filaments, cross-link actin filaments into bundles without polarity selectivity and protect them from dilution- and cofilin-mediated depolymerization; the function seems to involve its self-association (By similarity). In vitro can inhibit PKC/PRKCA activity. Proposed to be involved in cardiac stress signaling by down-regulating excessive PKC/PRKCA signaling (PubMed:27353086).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC208348 | Csrp3 (untagged) - Mouse cysteine and glycine-rich protein 3 (Csrp3), transcript variant 1, (10ug) |
CNY 3,990.00 |
|
MG201891 | Csrp3 (tGFP-tagged) - Mouse cysteine and glycine-rich protein 3 (Csrp3) |
CNY 5,200.00 |
|
MR201891L1 | Lenti ORF clone of Csrp3 (Myc-DDK-tagged) - Mouse cysteine and glycine-rich protein 3 (Csrp3), transcript variant 1 |
CNY 6,000.00 |
|
MR201891L2 | Lenti ORF clone of Csrp3 (mGFP-tagged) - Mouse cysteine and glycine-rich protein 3 (Csrp3), transcript variant 1 |
CNY 6,000.00 |
|
MR201891L3 | Lenti ORF clone of Csrp3 (Myc-DDK-tagged) - Mouse cysteine and glycine-rich protein 3 (Csrp3), transcript variant 1 |
CNY 3,800.00 |
|
MR201891L4 | Lenti ORF clone of Csrp3 (mGFP-tagged) - Mouse cysteine and glycine-rich protein 3 (Csrp3), transcript variant 1 |
CNY 6,000.00 |