Gpx4 (BC106147) Mouse Tagged ORF Clone
CAT#: MR201418
- TrueORF®
Gpx1 (Myc-DDK-tagged) - Mouse glutathione peroxidase 1 (Gpx1), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
ORF Plasmid: tGFP
"BC106147" in other vectors (2)
Need custom modification / cloning service?
Get a free quote
CN¥ 998.00
CN¥ 2,945.00
Specifications
Product Data | |
Type | Mouse Untagged ORF Clone |
Synonyms | 1700027O09Rik, PHGPx, mtPHGPx, snGPx |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR201418 representing BC106147
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTGTGCATCCCGCGATGATTGGCGCTGTGCGCGCTCCATGCACGAATTCTCAGCCAAGGACATCGACG GGCACATGGTCTGCCTGGATAAGTACAGGGGTTTCGTGTGCATCGTCACCAACGTGGCCTCGCAATGAGG CAAAACTGACGTAAACTACACTCAGCTAGTCGATCTGCATGCCCGATATGCTGAGTGTGGTTTACGAATC CTGGCCTTCCCCTGCAACCAGTTTGGGAGGCAGGAGCCAGGAAGTAATCAAGAAATCAAGGAGTTTGCAG CCGGCTACAACGTCAAGTTTGACATGTACAGCAAGATCTGTGTAAATGGGGACGATGCCCACCCACTGTG GAAATGGATGAAAGTCCAGCCCAAGGGCAGGGGCATGCTGGGAAATGCCATCAAATGGAACTTTACCAAG TTTCTCATTGATAAGAACGGCTGCGTGGTGAAGCGCTATGGTCCCATGGAGGAGCCCCAGGTGATAGAGA AGGACCTGCCGTGCTATCTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR201418 representing BC106147
Red=Cloning site Green=Tags(s) MCASRDDWRCARSMHEFSAKDIDGHMVCLDKYRGFVCIVTNVASQ*GKTDVNYTQLVDLHARYAECGLRI LAFPCNQFGRQEPGSNQEIKEFAAGYNVKFDMYSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTK FLIDKNGCVVKRYGPMEEPQVIEKDLPCYL myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | BC106147 |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins. |
OTI Annotation | This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | BC106147.1 |
RefSeq Size | 826 bp |
RefSeq ORF | 512 bp |
Locus ID | 625249 |
Gene Summary | The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of hydrogen peroxide, organic hydroperoxides and lipid hydroperoxides, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme has a high preference for lipid hydroperoxides and protects cells against membrane lipid peroxidation and cell death. It is also required for normal sperm development; thus, it has been identified as a 'moonlighting' protein because of its ability to serve dual functions as a peroxidase, as well as a structural protein in mature spermatozoa. Disruption of this gene in mouse spermatocytes is associated with male infertility. This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Transcript variants resulting from alternative splicing or use of alternate promoters have been described to encode isoforms with different subcellular localization. Pseudogenes of this locus have been identified on chromosomes 10 and 17. [provided by RefSeq, Jan 2019] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC207201 | Gpx4 (untagged) - Mouse glutathione peroxidase 4 (cDNA clone MGC:118087 IMAGE:4936866), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) |
CN¥ 3,230.00 |
|
MG201418 | Gpx4 (GFP-tagged) - Mouse glutathione peroxidase 4 (cDNA clone MGC:118087 IMAGE:4936866), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) |
CN¥ 2,544.00 |