Tyrobp (NM_011662) Mouse Tagged ORF Clone
CAT#: MR200474
- TrueORF®
Tyrobp (Myc-DDK-tagged) - Mouse TYRO protein tyrosine kinase binding protein (Tyrobp)
ORF Plasmid: tGFP
"NM_011662" in other vectors (5)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 4,180.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | DAP12; KARAP; Ly83 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200474 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGGGCTCTGGAGCCCTCCTGGTGCCTTCTGTTCCTTCCTGTCCTCCTGACTGTGGGAGGATTAAGTC CCGTACAGGCCCAGAGTGACACTTTCCCAAGATGCGACTGTTCTTCCGTGAGCCCTGGTGTACTGGCTGG GATTGTTCTGGGTGACTTGGTGTTGACTCTGCTGATTGCCCTGGCTGTGTACTCTCTGGGCCGCCTGGTC TCCCGAGGTCAAGGGACAGCGGAAGGGACCCGGAAACAACACATTGCTGAGACTGAGTCGCCTTATCAGG AGCTTCAGGGTCAGAGACCAGAAGTATACAGTGACCTCAACACACAGAGGCAATATTACAGA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200474 protein sequence
Red=Cloning site Green=Tags(s) MGALEPSWCLLFLPVLLTVGGLSPVQAQSDTFPRCDCSSVSPGVLAGIVLGDLVLTLLIALAVYSLGRLV SRGQGTAEGTRKQHIAETESPYQELQGQRPEVYSDLNTQRQYYR myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_011662 |
ORF Size | 345 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_011662.3 |
RefSeq Size | 586 bp |
RefSeq ORF | 345 bp |
Locus ID | 22177 |
UniProt ID | O54885 |
MW | 12.4 kDa |
Gene Summary | Adapter protein which non-covalently associates with activating receptors found on the surface of a variety of immune cells to mediate signaling and cell activation following ligand binding by the receptors (PubMed:15471863, PubMed:9647200). TYROBP is tyrosine-phosphorylated in the ITAM domain following ligand binding by the associated receptors which leads to activation of additional tyrosine kinases and subsequent cell activation (PubMed:15728241). Also has an inhibitory role in some cells (PubMed:21727189). Non-covalently associates with activating receptors of the CD300 family to mediate cell activation (By similarity). Also mediates cell activation through association with activating receptors of the CD200R family (PubMed:15471863). Required for neutrophil activation mediated by integrin (PubMed:17086186). Required for the activation of myeloid cells mediated by the CLEC5A/MDL1 receptor (By similarity). Associates with natural killer (NK) cell receptors such as the KLRD1/KLRC2 heterodimer to mediate NK cell activation (By similarity). Also associates non-covalently with the NK cell receptors KLRA4/LY49D and KLRA8/LY49H which leads to NK cell activation (PubMed:9647200). Associates with TREM1 to mediate activation of neutrophils and monocytes (By similarity). Associates with TREM2 on monocyte-derived dendritic cells to mediate up-regulation of chemokine receptor CCR7 and dendritic cell maturation and survival (By similarity). Association with TREM2 mediates cytokine-induced formation of multinucleated giant cells which are formed by the fusion of macrophages (PubMed:18957693). Stabilizes the TREM2 C-terminal fragment (TREM2-CTF) which is produced by TREM2 ectodomain shedding (By similarity). In microglia, required with TREM2 for phagocytosis of apoptotic neurons (PubMed:15728241). Required with ITGAM/CD11B in microglia to control production of microglial superoxide ions which promote the neuronal apoptosis that occurs during brain development (PubMed:18685038). Promotes proinflammatory responses in microglia following nerve injury which accelerates degeneration of injured neurons (PubMed:25690660). Positively regulates the expression of the IRAK3/IRAK-M kinase and IL10 production by liver dendritic cells and inhibits their T cell allostimulatory ability (PubMed:21257958). Negatively regulates B cell proliferation (PubMed:21727189). Required for CSF1-mediated osteoclast cytoskeletal organization (PubMed:18691974). Positively regulates multinucleation during osteoclast development (PubMed:12569157, PubMed:14969392).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MG200474 | Tyrobp (tGFP-tagged) - Mouse TYRO protein tyrosine kinase binding protein (Tyrobp) |
CNY 3,400.00 |
|
MR200474L1 | Lenti ORF clone of Tyrobp (Myc-DDK-tagged) - Mouse TYRO protein tyrosine kinase binding protein (Tyrobp) |
CNY 5,890.00 |
|
MR200474L2 | Lenti ORF clone of Tyrobp (mGFP-tagged) - Mouse TYRO protein tyrosine kinase binding protein (Tyrobp) |
CNY 4,200.00 |
|
MR200474L3 | Lenti ORF clone of Tyrobp (Myc-DDK-tagged) - Mouse TYRO protein tyrosine kinase binding protein (Tyrobp) |
CNY 5,890.00 |
|
MR200474L4 | Lenti ORF clone of Tyrobp (mGFP-tagged) - Mouse TYRO protein tyrosine kinase binding protein (Tyrobp) |
CNY 4,200.00 |