Ndufa7 (NM_023202) Mouse Tagged ORF Clone
CAT#: MR200458
- TrueORF®
Ndufa7 (Myc-DDK-tagged) - Mouse NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7 (B14.5a) (Ndufa7), nuclear gene encoding mitochondrial protein
ORF Plasmid: tGFP
"NM_023202" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,900.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | 14.5kD; 14.5kDa; 2400007M02Rik; CI-B14.5a |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200458 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGTCCGCTACTCGCGTTATCCAAAAGCTGCGGAACTGGGCGTCTGGGCAAGACCTGCAGGCGAAGC TACAGCTGCGCTACCAGGAGATCGCCAAGCGGACCCAGCCACCTCCGAAACTCCCCGTGGGCCCCAGTCA CAAGCTGTCCAACAATTACTACTGTACTCGTGATGGCCGCCGGGAAGTTGTGCCTCCCTCAATCATCATG TCCTCACAAAAGGCCCTGGTGTCAGGCAAGGCCGCCGAGAGTTCTGCAATGGCAGCCACTGAGAAGAAGG CAGTGACACCTGCTCCTCCCATGAAGAGGTGGGAGCTGTCCAAGGACCAGCCATACCTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200458 protein sequence
Red=Cloning site Green=Tags(s) MASATRVIQKLRNWASGQDLQAKLQLRYQEIAKRTQPPPKLPVGPSHKLSNNYYCTRDGRREVVPPSIIM SSQKALVSGKAAESSAMAATEKKAVTPAPPMKRWELSKDQPYL myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_023202 |
ORF Size | 342 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_023202.4 |
RefSeq Size | 540 bp |
RefSeq ORF | 342 bp |
Locus ID | 66416 |
UniProt ID | Q9Z1P6 |
MW | 12.6 kDa |
Gene Summary | This gene encodes a subunit of the NADH-ubiquinone oxidoreductase (complex I) enzyme, which is a large, multimeric protein. It is the first enzyme complex in the mitochondrial electron transport chain and catalyzes the transfer of electrons from NADH to the electron acceptor ubiquinone. The proton gradient created by electron transfer drives the conversion of ADP to ATP. Complex I has been biochemically separated into four fractions. The bovine ortholog of this protein has been reported to be part of the I-lambda fraction, which forms the extrinsic globular domain. In humans, deficiencies in complex I are associated with myopathies, encephalomyopathies, and neurodegenerative disorders. Pseudogenes of this gene are located on chromosomes 7 and 16. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC205082 | Ndufa7 (untagged) - Mouse NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7 (B14.5a) (Ndufa7), nuclear gene encoding mitochondrial protein, (10ug) |
CNY 1,200.00 |
|
MG200458 | Ndufa7 (tGFP-tagged) - Mouse NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7 (B14.5a) (Ndufa7) |
CNY 2,090.00 |
|
MR200458L3 | Lenti ORF clone of Ndufa7 (Myc-DDK-tagged) - Mouse NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7 (B14.5a) (Ndufa7), nuclear gene encoding mitochondrial protein |
CNY 3,800.00 |
|
MR200458L4 | Lenti ORF clone of Ndufa7 (mGFP-tagged) - Mouse NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7 (B14.5a) (Ndufa7), nuclear gene encoding mitochondrial protein |
CNY 3,800.00 |