Hmgn3 (BC005693) Mouse Tagged ORF Clone
CAT#: MR200264
- TrueORF®
Hmgn3 (Myc-DDK-tagged) - Mouse high mobility group nucleosomal binding domain 3 (cDNA clone MGC:11574 IMAGE:3597594)
ORF Plasmid: tGFP
"BC005693" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 2,945.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | TRIP7, HMGN3a, HMGN3b |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200264 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCGAAGAGAAAGTCTCCCGAGAACACAGAGGGCAAAGATGGAACCAAGCTAACTAAGCAGGAGCCCA CAAGACGGTCGGCCAGGTTGTCCGCGAAACCTGTTCCACCAAAACCGGAGTCTAAACCAAGAAAAACATC AGCTAAGAAAGAACCTGGAACAAAGATTAGCAGAGGTGCTAAGGGGAAGAAGGAAGAAAAGCAGGAAGCT GGAGAGGAAGGTACTGCACCATCTGCAAATGGTGACACTAAAGTTGAAGAGGTACTTTCCACAAACACCT CCCAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200264 protein sequence
Red=Cloning site Green=Tags(s) MPKRKSPENTEGKDGTKLTKQEPTRRSARLSAKPVPPKPESKPRKTSAKKEPGTKISRGAKGKKEEKQEA GEEGTAPSANGDTKVEEVLSTNTSH myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | BC005693 |
ORF Size | 285 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | BC005693, AAH05693 |
RefSeq Size | 1419 bp |
RefSeq ORF | 287 bp |
Locus ID | 94353 |
MW | 10.3 kDa |
Gene Summary | Binds to nucleosomes, regulating chromatin structure and consequently, chromatin-dependent processes such as transcription, DNA replication and DNA repair. Affects both insulin and glucagon levels and modulates the expression of pancreatic genes involved in insulin secretion. Regulates the expression of the glucose transporter SLC2A2 by binding specifically to its promoter region and recruiting PDX1 and additional transcription factors. Regulates the expression of SLC6A9, a glycine transporter which regulates the glycine concentration in synaptic junctions in the central nervous system, by binding to its transcription start site. May play a role in ocular development and astrocyte function.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC207028 | Hmgn3 (untagged) - Mouse high mobility group nucleosomal binding domain 3 (cDNA clone MGC:11574 IMAGE:3597594), (10ug) |
CNY 3,230.00 |
|
MG200264 | Hmgn3 (tGFP-tagged) - Mouse high mobility group nucleosomal binding domain 3 (cDNA clone MGC:11574 IMAGE:3597594) |
CNY 2,850.00 |
|
MR200264L3 | Lenti ORF clone of Hmgn3 (Myc-DDK-tagged) - Mouse high mobility group nucleosomal binding domain 3 (cDNA clone MGC:11574 IMAGE:3597594) |
CNY 4,750.00 |
|
MR200264L4 | Lenti ORF clone of Hmgn3 (mGFP-tagged) - Mouse high mobility group nucleosomal binding domain 3 (cDNA clone MGC:11574 IMAGE:3597594) |
CNY 4,750.00 |