Selenok (NM_019979) Mouse Tagged ORF Clone
CAT#: MR200234
- TrueORF®
Sepp1 (Myc-DDK-tagged) - Mouse selenoprotein P, plasma, 1 (Sepp1), transcript variant 3, (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
ORF Plasmid: tGFP
"NM_019979" in other vectors (2)
Need custom modification / cloning service?
Get a free quote
CNY 998.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Untagged ORF Clone |
Synonyms | 30kD; 1110001C03Rik; AA673253; Hsp30; HSPC0; HSPC030; Se; Selk |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200234 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTTTACATCTCGAATGGTCAGGTGTTGGACAGCAGGAATCAGTCCCCATGGAGAGTGTCTTTCCTAA CAGACTTCTTCTGGGGAATAGCAGAATTCGTGGTTTTCTTTTTCAAAACTCTGCTTCAGCAAGATGTGAA GAAAAGAAGAGGCTACGGGAGCTCCTCTGATTCCAGATACGACGATGGAAGAGGGCCACCAGGAAACCCT CCGCGAAGAATGGGTAGGATCAGTCACCTTCGTGGCCCCAGCCCTCCTCCAATGGCTGGTGGATGAGGAA GG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200234 protein sequence
Red=Cloning site Green=Tags(s) MVYISNGQVLDSRNQSPWRVSFLTDFFWGIAEFVVFFFKTLLQQDVKKRRGYGSSSDSRYDDGRGPPGNP PRRMGRISHLRGPSPPPMAGG*GR myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_019979 |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins. |
OTI Annotation | This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_019979.1, NM_019979.2, NP_064363.2 |
RefSeq Size | 1018 bp |
RefSeq ORF | 285 bp |
Locus ID | 80795 |
UniProt ID | Q9JLJ1 |
Gene Summary | The protein encoded by this gene belongs to the selenoprotein K family. It is a transmembrane protein that is localized in the endoplasmic reticulum (ER), and is involved in ER-associated degradation (ERAD) of misfolded, glycosylated proteins. It also has a role in the protection of cells from ER stress-induced apoptosis. Knockout studies in mice show the importance of this gene in promoting Ca(2+) flux in immune cells and mounting effective immune response. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec). Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Multiple pseudogenes of this locus have been identified. [provided by RefSeq, Sep 2017] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC203073 | Selk (untagged) - Mouse selenoprotein K (Selk), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) |
CNY 1,936.00 |
|
MG200234 | Selk (GFP-tagged) - Mouse selenoprotein K (Selk), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) |
CNY 2,544.00 |
其它Selenok产品