Fxyd3 (BC051033) Mouse Tagged ORF Clone
CAT#: MR200072
- TrueORF®
Fxyd3 (Myc-DDK-tagged) - Mouse FXYD domain-containing ion transport regulator 3 (cDNA clone MGC:54741 IMAGE:4460667)
ORF Plasmid: tGFP
"BC051033" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CN¥ 1,200.00
CN¥ 2,945.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | Mat8 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200072 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCAAGAGGTTGTTCTGAGCCTGTTGGTCCTTCTAGCAGGCCTGCCTACTTTGGATGCCAATGACCCTG AAAATAAAAATGATCCTTTCTACTATGATTGGTACAGCCTCCGAGTCGGCGGGCTCATTTGTGCAGGGAT TCTCTGTGCCCTGGGCATTATAGTCCTTATGAGTGGCAAATGCAAATGCAAGTTCAGACAGAAACCCAGG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200072 protein sequence
Red=Cloning site Green=Tags(s) MQEVVLSLLVLLAGLPTLDANDPENKNDPFYYDWYSLRVGGLICAGILCALGIIVLMSGKCKCKFRQKPR myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | BC051033 |
ORF Size | 210 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | BC051033, AAH51033 |
RefSeq Size | 989 bp |
RefSeq ORF | 212 bp |
Locus ID | 17178 |
MW | 7.8 kDa |
Gene Summary | This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The encoded protein is a transmembrane protein that functions as a specific regulator of Na,K-ATPase. [provided by RefSeq, Aug 2009] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC206840 | Fxyd3 (untagged) - Mouse FXYD domain-containing ion transport regulator 3 (cDNA clone MGC:54741 IMAGE:4460667), (10ug) |
CN¥ 3,230.00 |
|
MG200072 | Fxyd3 (tGFP-tagged) - Mouse FXYD domain-containing ion transport regulator 3 (cDNA clone MGC:54741 IMAGE:4460667) |
CN¥ 2,850.00 |
|
MR200072L3 | Lenti ORF clone of Fxyd3 (Myc-DDK-tagged) - Mouse FXYD domain-containing ion transport regulator 3 (cDNA clone MGC:54741 IMAGE:4460667) |
CN¥ 4,750.00 |
|
MR200072L4 | Lenti ORF clone of Fxyd3 (mGFP-tagged) - Mouse FXYD domain-containing ion transport regulator 3 (cDNA clone MGC:54741 IMAGE:4460667) |
CN¥ 4,750.00 |