Sirt2 (NM_001122765) Mouse Tagged ORF Clone

CAT#: MG225717

  • TrueORF®

Sirt2 (tGFP-tagged) - Mouse sirtuin 2 (silent mating type information regulation 2 homolog) 2 (S. cerevisiae) (Sirt2) transcript variant 2, (10ug)

ORF Plasmid: DDK tGFP



  "NM_001122765" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 4,280.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms 5730427M03Rik; Sir2l; SIR2L2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG225717 representing NM_001122765
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGAGCCGGACCCCTCTGACCCTCTGGAGACCCAGGCAGGGAAGGTGCAGGAGGCTCAGGATTCAG
ACTCGGACACTGAGGGAGGAGCCACTGGTGGAGAGGCAGAGATGGACTTCCTGAGGAATTTATTCACCCA
GACCCTGGGCCTGGGTTCCCAAAAGGAGCGTCTTCTAGACGAGCTGACCCTCGAAGGAGTGACACGCTAC
ATGCAGAGCGAGCGCTGCCGCAAGGTCATCTGTTTGGTGGGAGCCGGAATCTCCACGTCCGCGGGTATCC
CTGACTTCCGCTCCCCATCCACTGGCCTCTATGCAAACCTGGAGAAGTACCACCTTCCTTACCCAGAGGC
CATCTTTGAGATCAGCTACTTCAAGAAACATCCGGAACCCTTCTTTGCCCTTGCCAAGGAGCTCTATCCC
GGGCAGTTCAAGCCAACCATCTGCCACTACTTCATCCGCCTGCTGAAGGAGAAGGGGCTGCTGCTGCGCT
GCTACACGCAGAACATAGACACGCTGGAACGAGTGGCGGGGCTGGAGCCCCAGGACCTGGTGGAGGCCCA
CGGCACCTTCTACACATCACACTGTGTCAACACCTCCTGCAGAAAAGAATACACGATGGGCTGGATGAAA
GAGAAGATCTTCTCAGAAGCAACTCCCAGGTGTGAGCAGTGTCAGAGCGTGGTAAAGCCCGATATCGTGT
TTTTCGGTGAGAACCTTCCACCGCGCTTCTTCTCCTGCATGCAGTCAGACTTCTCCAAGGTGGACCTCCT
CATCATCATGGGCACCTCCCTGCAGGTGCAGCCCTTCGCCTCCCTCATCAGCAAGGCACCACTAGCCACC
CCACGGCTGCTCATTAACAAGGAAAAGACAGGCCAGACGGACCCCTTCCTGGGCATGATGATGGGCCTGG
GAGGTGGCATGGATTTTGACTCCAAGAAGGCTTACAGGGACGTGGCCTGGCTGGGTGACTGTGATCAAGG
CTGCCTGGCTCTCGCTGACCTCCTCGGATGGAAGAAGGAACTGGAAGACCTTGTCCGGAGGGAGCATGCC
AACATAGATGCCCAGTCAGGGTCACAGGCCCCCAACCCCAGCACTACCATCTCCCCTGGAAAGTCCCCAC
CGCCTGCCAAGGAGGCGGCCAGGACCAAAGAGAAAGAGGAACAGCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG225717 representing NM_001122765
Red=Cloning site Green=Tags(s)

MAEPDPSDPLETQAGKVQEAQDSDSDTEGGATGGEAEMDFLRNLFTQTLGLGSQKERLLDELTLEGVTRY
MQSERCRKVICLVGAGISTSAGIPDFRSPSTGLYANLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYP
GQFKPTICHYFIRLLKEKGLLLRCYTQNIDTLERVAGLEPQDLVEAHGTFYTSHCVNTSCRKEYTMGWMK
EKIFSEATPRCEQCQSVVKPDIVFFGENLPPRFFSCMQSDFSKVDLLIIMGTSLQVQPFASLISKAPLAT
PRLLINKEKTGQTDPFLGMMMGLGGGMDFDSKKAYRDVAWLGDCDQGCLALADLLGWKKELEDLVRREHA
NIDAQSGSQAPNPSTTISPGKSPPPAKEAARTKEKEEQQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001122765
ORF Size 1056 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001122765.1, NP_001116237.1
RefSeq Size 1816 bp
RefSeq ORF 1059 bp
Locus ID 64383
UniProt ID Q8VDQ8
Gene Summary NAD-dependent protein deacetylase, which deacetylates internal lysines on histone and alpha-tubulin as well as many other proteins such as key transcription factors (PubMed:17521387, PubMed:17681146, PubMed:17574768, PubMed:19037106, PubMed:22014574, PubMed:21791548, PubMed:21841822, PubMed:24334550). Participates in the modulation of multiple and diverse biological processes such as cell cycle control, genomic integrity, microtubule dynamics, cell differentiation, metabolic networks, and autophagy. Plays a major role in the control of cell cycle progression and genomic stability. Functions in the antephase checkpoint preventing precocious mitotic entry in response to microtubule stress agents, and hence allowing proper inheritance of chromosomes. Positively regulates the anaphase promoting complex/cyclosome (APC/C) ubiquitin ligase complex activity by deacetylating CDC20 and FZR1, then allowing progression through mitosis. Associates both with chromatin at transcriptional start sites (TSSs) and enhancers of active genes. Plays a role in cell cycle and chromatin compaction through epigenetic modulation of the regulation of histone H4 'Lys-20' methylation (H4K20me1) during early mitosis. Specifically deacetylates histone H4 at 'Lys-16' (H4K16ac) between the G2/M transition and metaphase enabling H4K20me1 deposition by KMT5A leading to ulterior levels of H4K20me2 and H4K20me3 deposition throughout cell cycle, and mitotic S-phase progression. Deacetylates KMT5A modulating KMT5A chromatin localization during the mitotic stress response. Deacetylates also histone H3 at 'Lys-57' (H3K56ac) during the mitotic G2/M transition. During oocyte meiosis progression, may deacetylate histone H4 at 'Lys-16' (H4K16ac) and alpha-tubulin, regulating spindle assembly and chromosome alignment by influencing microtubule dynamics and kinetochore function. Deacetylates histone H4 at 'Lys-16' (H4K16ac) at the VEGFA promoter and thereby contributes to regulate expression of VEGFA, a key regulator of angiogenesis. Deacetylates alpha-tubulin at 'Lys-40' and hence controls neuronal motility, oligodendroglial cell arbor projection processes and proliferation of non-neuronal cells. Phosphorylation at Ser-368 by a G1/S-specific cyclin E-CDK2 complex inactivates SIRT2-mediated alpha-tubulin deacetylation, negatively regulating cell adhesion, cell migration and neurite outgrowth during neuronal differentiation. Deacetylates PARD3 and participates in the regulation of Schwann cell peripheral myelination formation during early postnatal development and during postinjury remyelination. Involved in several cellular metabolic pathways. Plays a role in the regulation of blood glucose homeostasis by deacetylating and stabilizing phosphoenolpyruvate carboxykinase PCK1 activity in response to low nutrient availability. Acts as a key regulator in the pentose phosphate pathway (PPP) by deacetylating and activating the glucose-6-phosphate G6PD enzyme, and therefore, stimulates the production of cytosolic NADPH to counteract oxidative damage. Maintains energy homeostasis in response to nutrient deprivation as well as energy expenditure by inhibiting adipogenesis and promoting lipolysis. Attenuates adipocyte differentiation by deacetylating and promoting FOXO1 interaction to PPARG and subsequent repression of PPARG-dependent transcriptional activity. Plays a role in the regulation of lysosome-mediated degradation of protein aggregates by autophagy in neuronal cells. Deacetylates FOXO1 in response to oxidative stress or serum deprivation, thereby negatively regulating FOXO1-mediated autophagy (By similarity). Deacetylates a broad range of transcription factors and co-regulators regulating target gene expression. Deacetylates transcriptional factor FOXO3 stimulating the ubiquitin ligase SCF(SKP2)-mediated FOXO3 ubiquitination and degradation (By similarity). Deacetylates HIF1A and therefore promotes HIF1A degradation and inhibition of HIF1A transcriptional activity in tumor cells in response to hypoxia. Deacetylates RELA in t
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...