Prkcd (BC051416) Mouse Tagged ORF Clone

CAT#: MG207804

  • TrueORF®

Prkcd (tGFP-tagged) - Mouse protein kinase C, delta (cDNA clone MGC:58920 IMAGE:6515302)

ORF Plasmid: DDK tGFP



  "BC051416" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 5,320.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms PKC[d], PKCdelta
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG207804 representing BC051416
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCACCCTTCCTGCGCATCTCCTTCAATTCCTATGAGCTGGGCTCCCTGCAAGTTGAGGACGAAGCAA
GCCAGCCTTTCTGTGCTGTGAAGATGAAGGAGGCACTCAGCACAGAGCGAGGGAAGACACTGGTACAGAA
GAAGCCCACCATGTATCCTGAGTGGAAGACAACGTTCGACGCCCACATCTATGAAGGCCGTGTTATCCAG
ATTGTGCTGATGCGGGCAGCTGAAGACCCCGTGTCTGAGGTCACGGTGGGCGTGTCAGTACTGGCTGAGC
GCTGCAAGAAGAACAACGGCAAGGCTGAGTTCTGGCTGGATCTGCAGCCTCAGGCCAAGGTGCTGATGTG
TGTGCAGTATTTCCTGGAGGATGGGGATTGCAAACAGTCTATGCGTAGTGAGGAGGAGGCAAAGTTTCCA
ACCATGAACCGTCGTGGAGCCATTAAACAGGCCAAGATCCACTACATCAAGAACCACGAGTTTATCGCCA
CCTTCTTCGGGCAGCCCACCTTCTGTTCTGTGTGCAAAGAGTTTGTCTGGGGCCTCAACAAGCAAGGCTA
CAAATGCAGGCAATGCAACGCTGCCATCCACAAGAAATGCATTGACAAGATTATCGGCCGCTGCACTGGC
ACTGCCACCAATAGCCGGGACACCATCTTCCAGAAAGAACGCTTCAACATCGACATGCCTCACCGATTCA
AGGTTTATAACTACATGAGCCCCACCTTCTGTGACCACTGTGGCAGTTTGCTCTGGGGACTGGTGAAGCA
GGGATTAAAGTGTGAAGATTGTGGCATGAATGTGCACCACAAATGCCGGGAGAAGGTGGCCAACCTGTGT
GGTATCAACCAAAAGCTCTTGGCTGAGGCCTTGAACCAAGTGACCCAGAGATCTTCCCGGAAGCTGGACA
CAACAGAGTCTGTCGGAATATACCAGGGATTTGAGAAGAAGCCAGAAGTCTCTGGGAGTGACATCCTAGA
CAACAACGGGACCTATGGCAAGATCTGGGAGGGGAGCACCCGGTGCACCCTTGAGAACTTCACCTTCCAA
AAAGTACTTGGCAAAGGCAGCTTTGGCAAGGTGCTGCTGGCAGAGCTGAAGGGCAAAGACAAGTACTTTG
CAATCAAGTGTCTGAAGAAGGACGTGGTGTTGATTGACGATGATGTAGAGTGTACCATGGTGGAGAAGCG
GGTGCTGGCGCTCGCCTGGGAGAGTCCCTTCCTCACCCACCTCATCTGTACCTTCCAGACCAAGGACCAC
CTGTTCTTCGTGATGGAGTTTCTCAATGGGGGTGACCTGATGTTCCACATTCAGGACAAAGGCCGCTTCG
AACTCTACCGGGCTACGTTTTATGCAGCTGAGATCATCTGCGGACTGCAGTTTCTACACAGCAAAGGCAT
TATTTACAGGTATTGTTGGTGCTGGGGGCCGTGGGGAGGGACTTCTGGGAAGGCTGTTGCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG207804 representing BC051416
Red=Cloning site Green=Tags(s)

MAPFLRISFNSYELGSLQVEDEASQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKTTFDAHIYEGRVIQ
IVLMRAAEDPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMCVQYFLEDGDCKQSMRSEEEAKFP
TMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTG
TATNSRDTIFQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLC
GINQKLLAEALNQVTQRSSRKLDTTESVGIYQGFEKKPEVSGSDILDNNGTYGKIWEGSTRCTLENFTFQ
KVLGKGSFGKVLLAELKGKDKYFAIKCLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTKDH
LFFVMEFLNGGDLMFHIQDKGRFELYRATFYAAEIICGLQFLHSKGIIYRYCWCWGPWGGTSGKAVA

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC051416
ORF Size 1461 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC051416.1
RefSeq Size 2517 bp
RefSeq ORF 1463 bp
Locus ID 18753
Gene Summary Calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that plays contrasting roles in cell death and cell survival by functioning as a pro-apoptotic protein during DNA damage-induced apoptosis, but acting as an anti-apoptotic protein during cytokine receptor-initiated cell death, is involved in tumor suppression, is required for oxygen radical production by NADPH oxidase and acts as positive or negative regulator in platelet functional responses. Negatively regulates B cell proliferation and also has an important function in self-antigen induced B cell tolerance induction. Upon DNA damage, activates the promoter of the death-promoting transcription factor BCLAF1/Btf to trigger BCLAF1-mediated p53/TP53 gene transcription and apoptosis. In response to oxidative stress, interact with and activate CHUK/IKKA in the nucleus, causing the phosphorylation of p53/TP53. In the case of ER stress or DNA damage-induced apoptosis, can form a complex with the tyrosine-protein kinase ABL1 which trigger apoptosis independently of p53/TP53. In cytosol can trigger apoptosis by activating MAPK11 or MAPK14, inhibiting AKT1 and decreasing the level of X-linked inhibitor of apoptosis protein (XIAP), whereas in nucleus induces apoptosis via the activation of MAPK8 or MAPK9. Upon ionizing radiation treatment, is required for the activation of the apoptosis regulators BAX and BAK, which trigger the mitochondrial cell death pathway. Can phosphorylate MCL1 and target it for degradation which is sufficient to trigger for BAX activation and apoptosis. Is required for the control of cell cycle progression both at G1/S and G2/M phases. Mediates phorbol 12-myristate 13-acetate (PMA)-induced inhibition of cell cycle progression at G1/S phase by up-regulating the CDK inhibitor CDKN1A/p21 and inhibiting the cyclin CCNA2 promoter activity. In response to UV irradiation can phosphorylate CDK1, which is important for the G2/M DNA damage checkpoint activation. Can protect glioma cells from the apoptosis induced by TNFSF10/TRAIL, probably by inducing increased phosphorylation and subsequent activation of AKT1. Can also act as tumor suppressor upon mitogenic stimulation with PMA or TPA. In N-formyl-methionyl-leucyl-phenylalanine (fMLP)-treated cells, is required for NCF1 (p47-phox) phosphorylation and activation of NADPH oxidase activity, and regulates TNF-elicited superoxide anion production in neutrophils, by direct phosphorylation and activation of NCF1 or indirectly through MAPK1/3 (ERK1/2) signaling pathways. May also play a role in the regulation of NADPH oxidase activity in eosinophil after stimulation with IL5, leukotriene B4 or PMA. In collagen-induced platelet aggregation, acts a negative regulator of filopodia formation and actin polymerization by interacting with and negatively regulating VASP phosphorylation. Downstream of PAR1, PAR4 and CD36/GP4 receptors, regulates differentially platelet dense granule secretion; acts as a positive regulator in PAR-mediated granule secretion, whereas it negatively regulates CD36/GP4-mediated granule release. Phosphorylates MUC1 in the C-terminal and regulates the interaction between MUC1 and beta-catenin. The catalytic subunit phosphorylates 14-3-3 proteins (YWHAB, YWHAZ and YWHAH) in a sphingosine-dependent fashion. Phosphorylates ELAVL1 in response to angiotensin-2 treatment (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...