Lgals9 (BC003754) Mouse Tagged ORF Clone

CAT#: MG204650

  • TrueORF®

Lgals9 (tGFP-tagged) - Mouse lectin, galactose binding, soluble 9 (cDNA clone MGC:5882 IMAGE:3601419)



  "BC003754" in other vectors (1)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,850.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


Recombinant Anti-Galectin 9 (Clone RG9-35)
    • 200 ug

CNY 6,881.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms AA407335; AI194909; AI265545; gal-9; galectin-9; Lgals5; LGALS35
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG204650 representing BC003754
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCTCTTCAGTGCCCAGTCTCCATACATTAACCCGATCATCCCCTTTACTGGACCAATCCAAGGAG
GGCTGCAGGAGGGACTTCAGGTGACCCTCCAGGGGACTACCAAGAGTTTTGCACAAAGGTTTGTGGTGAA
CTTTCAGAACAGCTTCAATGGAAATGACATTGCCTTCCACTTCAACCCCCGGTTTGAGGAAGGAGGGTAT
GTGGTTTGCAACACGAAGCAGAACGGACAGTGGGGGCCTGAGGAGAGAAAGATGCAGATGCCCTTCCAGA
AGGGGATGCCCTTTGAGCTTTGCTTCCTGGTGCAGAGGTCAGAGTTCAAGGTGATGGTGAACAAGAAATT
CTTTGTGCAGTACCAACACCGCGTACCCTACCACCTCGTGGACACCATCGCTGTCTCCGGCTGCTTGAAG
CTGTCCTTTATCACCTTCCAGACTCAGGACTTTCGTCCTGCCCACCAGGCACCCATGGCTCAAACTACCA
TCCATATGGTTCACAGCACCCCTGGACAGATGTTCTCTACTCCTGGAATCCCTCCTGTGGTGTACCCCAC
CCCAGCCTATACCATACCTTTCTACACCCCCATTCCAAATGGGCTTTACCCGTCCAAGTCCATCATGATA
TCAGGCAATGTCTTGCCAGATGCTACGAGGTTCCATATCAACCTTCGCTGTGGAGGTGACATTGCTTTCC
ACCTGAACCCCCGTTTCAATGAGAATGCTGTTGTCCGAAACACTCAGATCAACAACTCCTGGGGGCAGGA
AGAGCGAAGTCTGCTTGGGAGGATGCCCTTCAGTCGAGGCCAGAGCTTCTCGGTGTGGATCATATGCGAA
GGTCACTGCTTCAAGGTGGCTGTGAATGGTCAACACATGTGTGAATATTACCACCGCCTGAAGAACTTGC
AGGATATCAACACTCTAGAAGTGGCGGGTGATATCCAGCTGACCCACGTGCAGACA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG204650 representing BC003754
Red=Cloning site Green=Tags(s)

MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGY
VVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLK
LSFITFQTQDFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMI
SGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICE
GHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC003754
ORF Size 968 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC003754, AAH03754
RefSeq Size 1433 bp
RefSeq ORF 968 bp
Locus ID 16859
Gene Summary Binds galactosides (By similarity). Has high affinity for the Forssman pentasaccharide (By similarity). Ligand for HAVCR2/TIM3 (By similarity). Binding to HAVCR2 induces T-helper type 1 lymphocyte (Th1) death (By similarity). Also stimulates bactericidal activity in infected macrophages by causing macrophage activation and IL1B secretion which restricts intracellular bacterial growth (PubMed:20937702). Ligand for P4HB; the interaction retains P4HB at the cell surface of Th2 T-helper cells, increasing disulfide reductase activity at the plasma membrane, altering the plasma membrane redox state and enhancing cell migration (PubMed:21670307). Ligand for CD44; the interaction enhances binding of SMAD3 to the FOXP3 promoter, leading to up-regulation of FOXP3 expression and increased induced regulatory T (iTreg) cell stability and suppressive function (PubMed:25065622). Promotes ability of mesenchymal stromal cells to suppress T-cell proliferation (By similarity). Expands regulatory T-cells and induces cytotoxic T-cell apoptosis following virus infection (By similarity). Activates ERK1/2 phosphorylation inducing cytokine (IL-6, IL-8, IL-12) and chemokine (CCL2) production in mast and dendritic cells (By similarity). Inhibits degranulation and induces apoptosis of mast cells (By similarity). Induces maturation and migration of dendritic cells (By similarity). Inhibits natural killer (NK) cell function (PubMed:23408620). Can transform NK cell phenotype from peripheral to decidual during pregnancy (By similarity). Astrocyte derived galectin-9 enhances microglial TNF production (PubMed:25158758). May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. May provide the molecular basis for urate flux across cell membranes, allowing urate that is formed during purine metabolism to efflux from cells and serving as an electrogenic transporter that plays an important role in renal and gastrointestinal urate excretion (By similarity). Highly selective to the anion urate (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...