Rab8a (NM_023126) Mouse Tagged ORF Clone

CAT#: MG202203

  • TrueORF®

Rab8a (tGFP-tagged) - Mouse RAB8A, member RAS oncogene family (Rab8a)

ORF Plasmid: DDK tGFP



  "NM_023126" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 5,200.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms AA409338; Mel
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG202203 representing NM_023126
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGAAGACCTACGATTACCTGTTCAAGCTGCTGCTGATCGGGGACTCGGGGGTAGGGAAGACCTGTG
TCCTGTTCCGCTTCTCCGAGGACGCCTTCAACTCCACATTCATCTCTACCATAGGAATTGACTTTAAAAT
TAGGACCATAGAGCTCGATGGCAAGAGGATTAAACTGCAGATATGGGACACGGCCGGCCAGGAGCGGTTT
CGAACAATCACGACAGCCTACTACAGGGGTGCCATGGGTATCATGCTGGTCTACGACATTACCAATGAGA
AGTCCTTTGACAACATCCGGAATTGGATTCGGAACATTGAAGAGCATGCCTCTGCAGACGTGGAGAAGAT
GATACTGGGGAATAAGTGTGATGTGAATGACAAGAGACAGGTGTCCAAGGAACGGGGAGAAAAGCTGGCA
CTCGACTATGGGATCAAGTTCATGGAGACCAGTGCAAAGGCCAACATTAATGTGGAGAATGCATTTTTCA
CTCTTGCCAGGGATATCAAAGCAAAAATGGACAAAAAATTGGAAGGGAACAGCCCGCAGGGGAGCAGCCA
TGGAGTCAAGATCACAGTGGAGCAGCAGAAGAGGACCAGCTTCTTCCGGTGCAGTCTCCTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG202203 representing NM_023126
Red=Cloning site Green=Tags(s)

MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERF
RTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLA
LDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSSHGVKITVEQQKRTSFFRCSLL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_023126
ORF Size 621 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_023126.2, NP_075615.2
RefSeq Size 2012 bp
RefSeq ORF 624 bp
Locus ID 17274
UniProt ID P55258
Gene Summary The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in polarized vesicular trafficking and neurotransmitter release. Together with RAB11A, RAB3IP, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B and RAB11A participates in epithelial cell polarization. Plays an important role in ciliogenesis (By similarity). Together with MICALL2, may also regulate adherens junction assembly (PubMed:18094055). May play a role in insulin-induced transport to the plasma membrane of the glucose transporter GLUT4 and therefore play a role in glucose homeostasis (By similarity). Involved in autophagy (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...