Bnip3 (BC046603) Mouse Tagged ORF Clone

CAT#: MG201757

  • TrueORF®

Bnip3 (tGFP-tagged) - Mouse BCL2/adenovirus E1B interacting protein 1, NIP3 (cDNA clone MGC:54681 IMAGE:6390074)



Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,850.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms Nip3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG201757 representing BC046603
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCAGAGCGGGGAGGAGAACCTGCAGGGCTCCTGGGTAGAACTGCACTTCAGCAATGGCAATGGGA
GCAGCGTTCCAGCCTCCGTCTCTATTTATAATGGTGACATGGAAAAAATACTGTTGGATGCCCAGCATGA
ATCTGGACGAAGTAGCTCCAAGAGTTCTCACTGTGACAGCCCACCTCGCTCCCAGACACCACAAGATACC
AACAGAGCTGAAATAGACAGCCACAGCTTTGGCGAGAAAAACAGCACTCTGTCTGAGGAAGATTATATTG
AGAGAAGAAGAGAAGTTGAAAGTATCCTGAAGAAAAACTCAGATTGGATATGGGATTGGTCAAGTCGACC
AGAAAATATTCCCCCCAAGGAGTTCCTTTTTAAACACCCGAAGCGCACAGCTACTCTCAGCATGAGAAAC
ACAAGCGTTATGAAGAAAGGGGGAATTTTCTCAGCAGACTTTCTGAAGGTTTTCCTTCCATCTCTGTTAC
TGTCTCATCTGCTGGCCATTGGCTTGGGGATCTACATTGGAAGGCGTCTGACAACTTCCACTAGCACCTT
C


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG201757 representing BC046603
Red=Cloning site Green=Tags(s)

MSQSGEENLQGSWVELHFSNGNGSSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDT
NRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRN
TSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC046603
ORF Size 563 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC046603, AAH46603
RefSeq Size 1720 bp
RefSeq ORF 563 bp
Locus ID 12176
Gene Summary Apoptosis-inducing protein that can overcome BCL2 suppression. May play a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2 (By similarity). Involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates in mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane may play a critical role in the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix (By similarity). The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane regulates the opening of a pore in the mitochondrial double membrane in order to mediate the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix (By similarity). Plays an important role in the calprotectin (S100A8/A9)-induced cell death pathway (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...