Pla2g2a (BC045156) Mouse Tagged ORF Clone

CAT#: MG200976

  • TrueORF®

Pla2g2a (tGFP-tagged) - Mouse phospholipase A2, group IIA (platelets, synovial fluid) (cDNA clone MGC:54610 IMAGE:6479080)



Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,850.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms EF, Pla2, sPLA2, 14-3-3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG200976 representing BC045156
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGTCCTCCTGCTGCTAGCAGCCTCGATCATGGCCTTTGGCTCAATACAGGTCCAAGGGAACATTG
CGCAGTTTGGGGAAATGATTCGGCTTAAGACAGGAAAGAGAGCTGAGCTTAGCTATGCCTTCTATGGATG
CCACTGTGGCCTGGGTGGCAAAGGATCCCCCAAGGATGCCACAGACCGGTGCTGTGTTACTCATGACTGT
TGCTACAAGAGCCTGGAGAAAAGTGGATGTGGTACTAAGTTACTGAAATACAAGTACTCCCACCAAGGGG
GCCAAATCACCTGTTCTGCAAACCAGAACTCCTGTCAGAAACGGCTGTGTCAGTGCGATAAAGCCGCCGC
TGAATGTTTCGCCCGGAACAAGAAAACCTACAGTTTAAAGTACCAGTTCTACCCCAACATGTTTTGCAAA
GGGAAGAAGCCCAAATGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG200976 representing BC045156
Red=Cloning site Green=Tags(s)

MKVLLLLAASIMAFGSIQVQGNIAQFGEMIRLKTGKRAELSYAFYGCHCGLGGKGSPKDATDRCCVTHDC
CYKSLEKSGCGTKLLKYKYSHQGGQITCSANQNSCQKRLCQCDKAAAECFARNKKTYSLKYQFYPNMFCK
GKKPKC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC045156
ORF Size 440 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC045156, AAH45156
RefSeq Size 793 bp
RefSeq ORF 440 bp
Locus ID 18780
Gene Summary Proteins belonging to the phospholipase A2 (PLA2) family hydrolyze phospholipids into sn2 fatty acids and lysophospholipids. They function in a variety of cellular processes, including the digestion of phospholipids and the production of molecules that induce inflammatory responses. This gene encodes a member of the group II class of secretory PLA2s. The secreted enzyme binds to heparin on the cell surface. Mutations in this gene increase the occurrence of intestinal polyps caused by a dominant mutation in the adenomatosis polyposis coli gene. A frameshift inactivates this gene product in some mouse strains including the strain of the reference genome, C57BL/6J, whereas a functional protein is produced in other strains. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...