Cxcl10 (BC030067) Mouse Tagged ORF Clone
CAT#: MG200291
- TrueORF®
Cxcl10 (tGFP-tagged) - Mouse chemokine (C-X-C motif) ligand 10 (cDNA clone MGC:41087 IMAGE:1446589)
Need custom modification / cloning service?
Get a free quote
CNY 4,370.00
Cited in 4 publications. |
CNY 1,000.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | TurboGFP |
Synonyms | CRG-2, IP-10, C7, INP10, mob-1, gIP-10, IP10 |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MG200291 representing BC030067
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAACCCAAGTGCTGCCGTCATTTTCTGCCTCATCCTGCTGGGTCTGAGTGGGACTCAAGGGATCCCTC TCGCAAGGACGGTCCGCTGCAACTGCATCCATATCGATGACGGGCCAGTGAGAATGAGGGCCATAGGGAA GCTTGAAATCATCCCTGCGAGCCTATCCTGCCCACGTGTTGAGATCATTGCCACGATGAAAAAGAATGAT GAGCAGAGATGTCTGAATCCGGAATCTAAGACCATCAAGAATTTAATGAAAGCGTTTAGCCAAAAAAGGT CTAAAAGGGCTCCT ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA >MG200291 representing BC030067
Red=Cloning site Green=Tags(s) MNPSAAVIFCLILLGLSGTQGIPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKND EQRCLNPESKTIKNLMKAFSQKRSKRAP TRTRPLE - GFP Tag - V |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | BC030067 |
ORF Size | 296 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | BC030067, AAH30067 |
RefSeq Size | 1087 bp |
RefSeq ORF | 296 bp |
Locus ID | 15945 |
Gene Summary | Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects (By similarity) (PubMed:28623423). Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites (PubMed:18624292, PubMed:19017990, PubMed:28468883). Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization. In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation (By similarity). Activation of the CXCL10/CXCR3 axis plays also an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization (PubMed:15456824).[UniProtKB/Swiss-Prot Function] |
Citations (4)
The use of this cDNA Clones has been cited in the following citations: |
---|
Opening of the blood-brain barrier using low-intensity pulsed ultrasound enhances responses to immunotherapy in preclinical glioma models
,null,
Clinical cancer research : an official journal of the American Association for Cancer Research
,PubMed ID 34031054
[Cxcl10]
|
Isocitrate dehydrogenase mutations suppress STAT1 and CD8 + T cell accumulation in gliomas
,null,
The Journal of Clinical Investigation
,PubMed ID 28319047
[Cxcl10]
|
NLRC4 suppresses melanoma tumor progression independently of inflammasome activation
,null,
The Journal of Clinical Investigation
,PubMed ID 27617861
[Cxcl10]
|
Tumor-suppressive effects of natural-type interferon-β through CXCL10 in melanoma.
,null,
Biochemical and biophysical research communications
,PubMed ID 26102027
[Cxcl10]
|
Documents
Product Manuals |
FAQs |
SDS |