YES1 Rabbit Polyclonal Antibody

CAT#: TA358529

YES1 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 4,628.00


货期*
2周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 (YES1)
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 (YES1), 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Recombinant protein of human v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 (YES1), 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen is a synthetic peptide directed towards the following sequence EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTA
Specificity Expected reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Predicted Protein Size 61 kDa
Gene Name YES proto-oncogene 1, Src family tyrosine kinase
Background This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22.
Synonyms c-yes; HsT441; OTTHUMP00000162194; p61-Yes; Yes
Reference Data
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Adherens junction, Tight junction
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...