GNRH2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the following sequence SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV
Specificity	Expected reactivity: Human Homology: Human: 100%
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Predicted Protein Size	13 kDa
Gene Name	gonadotropin releasing hormone 2
Database Link	NP_001492 Entrez Gene 2797 Human UniProt ID O43555
Background	The protein encoded by this gene is a preproprotein that is cleaved to form a secreted 10 aa peptide hormone. The secreted decapeptide regulates reproduction in females by stimulating the secretion of both luteinizing- and follicle-stimulating hormones. Three transcript variants that encode unique proproteins but the same peptide hormone have been found for this gene.
Synonyms	GnRH-II; LH-RHII; OTTHUMP00000030076; OTTHUMP00000030077
Reference Data
Protein Families	Druggable Genome, Secreted Protein
Protein Pathways	GnRH signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.