Dehydrodolichyl Diphosphate Synthase (DHDDS) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DHDDS antibody is: synthetic peptide directed towards the C-terminal region of Human DHDDS. Synthetic peptide located within the following region: ARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	dehydrodolichyl diphosphate synthase subunit
Database Link	NP_001230493 Entrez Gene 79947 Human UniProt ID Q86SQ9
Background	The protein encoded by this gene catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins. Mutations in this gene are associated with retinitis pigmentosa type 59. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011]
Synonyms	CIT; CPT; DS; HDS; RP59
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%
Reference Data
Protein Pathways	Terpenoid backbone biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.