AASDHPPT Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-AASDHPPT antibody: synthetic peptide directed towards the C terminal of human AASDHPPT. Synthetic peptide located within the following region: SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
Database Link	NP_056238 Entrez Gene 60496 Human UniProt ID Q9NRN7
Background	The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia. [provided by RefSeq, Jul 2008]
Synonyms	AASD-PPT; CGI-80; LYS2; LYS5
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Pig: 93%; Rat: 92%; Dog: 86%; Rabbit: 86%; Guinea pig: 85%; Bovine: 79%
Reference Data
Protein Pathways	Lysine biosynthesis, Lysine degradation, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.