QPCT Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-QPCT antibody: synthetic peptide directed towards the middle region of human QPCT. Synthetic peptide located within the following region: SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	glutaminyl-peptide cyclotransferase
Database Link	NP_036545 Entrez Gene 25797 Human UniProt ID Q16769
Background	This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase. [provided by RefSeq, Jul 2008]
Synonyms	GCT; QC; sQC
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Sheep: 86%; Bovine: 86%; Dog: 79%; Horse: 79%; Mouse: 79%
Reference Data
Protein Families	Protease

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.