GPBB (PYGB) Rabbit Polyclonal Antibody

CAT#: TA346713

Rabbit Polyclonal Anti-PYGB Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 5,200.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of phosphorylase, glycogen; brain (PYGB)
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human phosphorylase, glycogen; brain (PYGB), 20 µg
    • 20 ug

CN¥ 2,900.00


Recombinant protein of human phosphorylase, glycogen; brain (PYGB), 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PYGB antibody: synthetic peptide directed towards the N terminal of human PYGB. Synthetic peptide located within the following region: QQHYYERDPKRIYYLSLEFYMGRTLQNTMVNLGLQNACDEAIYQLGLDLE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 97 kDa
Gene Name phosphorylase, glycogen; brain
Background The protein encoded by this gene is a glycogen phosphorylase found predominantly in the brain. The encoded protein forms homodimers which can associate into homotetramers, the enzymatically active form of glycogen phosphorylase. The activity of this enzyme is positively regulated by AMP and negatively regulated by ATP, ADP, and glucose-6-phosphate. This enzyme catalyzes the rate-determining step in glycogen degradation. [provided by RefSeq, Jul 2008]
Synonyms GPBB
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Sheep: 93%; Bovine: 93%; Zebrafish: 86%
Reference Data
Protein Families Druggable Genome
Protein Pathways Insulin signaling pathway, Starch and sucrose metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...