GGPS1 Rabbit Polyclonal Antibody
CAT#: TA346695
Rabbit Polyclonal Anti-GGPS1 Antibody
Need it in bulk or conjugated?
Get a free quote
CN¥ 4,628.00
CN¥ 2,900.00
CN¥ 6,650.00
CN¥ 3,080.00
CN¥ 9,998.00
CN¥ 3,080.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GGPS1 antibody: synthetic peptide directed towards the middle region of human GGPS1. Synthetic peptide located within the following region: LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 35 kDa |
Gene Name | geranylgeranyl diphosphate synthase 1 |
Database Link | |
Background | This gene is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, both protein-coding and non-protein-coding, have been found for this gene. [provided by RefSeq, Sep 2010] |
Synonyms | GGPPS; GGPPS1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92% |
Reference Data | |
Protein Pathways | Metabolic pathways, Terpenoid backbone biosynthesis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |